Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0473 protein CLK_1946 |
NCBI Accession ID | CP000962.1 |
Organism | Clostridium botulinum (strain Loch Maree / Type A3) |
Left | 2761474 |
Right | 2761731 |
Strand | - |
Nucleotide Sequence | ATGGATAATAATGTAGATACAATAACATTAACAGATGAAGAAGGAAAAAAAACTGAATTTGAGGTAATAACAAAGCTTGATATAGAAGATAAAGAATATGTAGTTGTAGTTCCAAAGGATGAAGAAGTAGATGAGGCTATAGCTCTTAGAATAGATAATAATGATAATGGTGAAGAAGTGTTAGTACCAGTAGAAGAAGATGAAGAATTTAATATGGTAGCAGAGGCTTATGAATTGCTATTTTCAGAAGAACAATAG |
Sequence | MDNNVDTITLTDEEGKKTEFEVITKLDIEDKEYVVVVPKDEEVDEAIALRIDNNDNGEEVLVPVEEDEEFNMVAEAYELLFSEEQ |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
Pubmed ID | 18060065 |
Domain | CDD:412983 |
Functional Category | Others |
Uniprot ID | B1KXB4 |
ORF Length (Amino Acid) | 85 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2646057 | 2646311 | - | NZ_CP028842.1 | Clostridium botulinum |
2 | 2896519 | 2896773 | - | NZ_CP011663.1 | Clostridium sporogenes |
3 | 1112085 | 1112351 | + | NZ_CP020953.1 | Clostridium drakei |
4 | 3155865 | 3156131 | - | NZ_CP009933.1 | Clostridium scatologenes |
5 | 72922 | 73188 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
6 | 2561855 | 2562112 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
7 | 1704367 | 1704630 | + | NZ_CP040924.1 | Clostridium thermarum |
8 | 1832157 | 1832420 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
9 | 863938 | 864207 | + | NZ_LT906477.1 | Clostridium cochlearium |
10 | 1791868 | 1792119 | + | NZ_CP014176.1 | Clostridium argentinense |
11 | 2291319 | 2291585 | - | NZ_CP013019.1 | Clostridium pasteurianum |
12 | 1281562 | 1281816 | + | NZ_CP032416.1 | Clostridium fermenticellae |
13 | 1470002 | 1470262 | - | NC_008593.1 | Clostridium novyi NT |
14 | 1362318 | 1362572 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
15 | 1883928 | 1884194 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
16 | 3553355 | 3553615 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
17 | 1317300 | 1317560 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
18 | 2271857 | 2272111 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
19 | 2216032 | 2216298 | + | NC_014393.1 | Clostridium cellulovorans 743B |
20 | 1309456 | 1309749 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01596.19 | 0.85 | 17 | 5211 | same-strand | O-methyltransferase |
2 | PF13578.8 | 0.85 | 17 | 5211 | same-strand | Methyltransferase domain |
3 | PF13649.8 | 0.7 | 14 | 5216.5 | same-strand | Methyltransferase domain |
4 | PF08241.14 | 0.8 | 16 | 5109.0 | same-strand | Methyltransferase domain |
5 | PF00009.29 | 0.95 | 19 | 2828 | same-strand | Elongation factor Tu GTP binding domain |
6 | PF00679.26 | 0.95 | 19 | 2828 | same-strand | Elongation factor G C-terminus |
7 | PF03144.27 | 0.95 | 19 | 2828 | same-strand | Elongation factor Tu domain 2 |
8 | PF01926.25 | 0.95 | 19 | 2828 | same-strand | 50S ribosome-binding GTPase |
9 | PF17770.3 | 0.9 | 18 | 653.5 | same-strand | Ribonuclease J C-terminal domain |
10 | PF07521.14 | 0.85 | 17 | 662 | same-strand | Zn-dependent metallo-hydrolase RNA specificity domain |
11 | PF01475.21 | 0.95 | 19 | 154 | same-strand | Ferric uptake regulator family |
12 | PF03652.17 | 1.0 | 20 | 27.0 | same-strand | Holliday junction resolvase |
13 | PF06135.14 | 1.0 | 20 | 559.0 | same-strand | IreB regulatory phosphoprotein |
14 | PF01411.21 | 1.0 | 20 | 906.0 | same-strand | tRNA synthetases class II (A) |
15 | PF02272.21 | 1.0 | 20 | 906.0 | same-strand | DHHA1 domain |
16 | PF07973.16 | 1.0 | 20 | 906.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
17 | PF01594.18 | 0.8 | 16 | 3959.5 | same-strand | AI-2E family transporter |
18 | PF05239.18 | 0.6 | 12 | 4996.0 | same-strand | PRC-barrel domain |