Result : EXP00475
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00475 |
| NCBI Accession ID | NC_016856.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 3241252 |
| Right | 3241356 |
| Strand | + |
| Nucleotide Sequence | TTGCAAGCGGGCCAGTCCCCTGAGCCGATATTTCATACCACAAGAATGTGGCGCTCCGCGGTTGGTGAGCATGCTCGGTTCGTCCGAGAAGCCTTAAAACTGTGA |
| Sequence | LQAGQSPEPIFHTTRMWRSAVGEHARFVREALKL |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 28122954 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5183712 | 5183816 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 2 | 3222119 | 3222223 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 3 | 1029579 | 1029683 | + | NZ_CP053416.1 | Salmonella bongori |
| 4 | 839172 | 839276 | - | NZ_CP050508.1 | Raoultella terrigena |
| 5 | 794969 | 795073 | - | NZ_CP054254.1 | Klebsiella variicola |
| 6 | 4243625 | 4243729 | - | NZ_CP038469.1 | Citrobacter tructae |
| 7 | 3807023 | 3807127 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 8 | 952650 | 952754 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 9 | 5396752 | 5396856 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 10 | 816601 | 816705 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 11 | 4446811 | 4446915 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 12 | 3920671 | 3920775 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 13 | 844281 | 844385 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 14 | 844780 | 844884 | + | NZ_CP026047.1 | Raoultella planticola |
| 15 | 778023 | 778127 | - | NZ_CP041247.1 | Raoultella electrica |
| 16 | 363357 | 363461 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 17 | 4046369 | 4046473 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 18 | 3954522 | 3954626 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 19 | 867667 | 867771 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 20 | 1832308 | 1832412 | + | NZ_CP033744.1 | Citrobacter freundii |
| 21 | 3277911 | 3278015 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 22 | 3964886 | 3964990 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 23 | 788673 | 788777 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 24 | 4351113 | 4351217 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 25 | 839670 | 839774 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 26 | 596167 | 596262 | - | NZ_LR134201.1 | Cedecea lapagei |
| 27 | 1367814 | 1367918 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 28 | 773898 | 774002 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 29 | 593947 | 594042 | - | NZ_CP023525.1 | Cedecea neteri |
| 30 | 681543 | 681647 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 31 | 780232 | 780327 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 32 | 3692377 | 3692472 | + | NZ_CP026377.1 | Mixta gaviniae |
| 33 | 499008 | 499127 | + | NZ_CP065640.1 | Serratia rubidaea |
| 34 | 2852321 | 2852416 | + | NZ_CP028271.1 | Mixta intestinalis |
| 35 | 2349589 | 2349684 | - | NZ_CP019706.1 | Pantoea alhagi |
| 36 | 428081 | 428176 | + | NZ_CP026364.1 | Proteus hauseri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06026.16 | 0.94 | 34 | 2346.0 | opposite-strand | Ribose 5-phosphate isomerase A (phosphoriboisomerase A) |
| 2 | PF02826.21 | 0.97 | 35 | 843 | opposite-strand | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
| 3 | PF00389.32 | 0.97 | 35 | 843 | opposite-strand | D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain |
| 4 | PF01842.27 | 0.94 | 34 | 843.5 | opposite-strand | ACT domain |
| 5 | PF01812.22 | 0.81 | 29 | 164 | same-strand | 5-formyltetrahydrofolate cyclo-ligase family |
| 6 | PF05164.15 | 0.94 | 34 | 57.0 | same-strand | Cell division protein ZapA |
| 7 | PF03695.15 | 1.0 | 36 | 551.0 | opposite-strand | Uncharacterised protein family (UPF0149) |
| 8 | PF00557.26 | 1.0 | 36 | 1159.0 | opposite-strand | Metallopeptidase family M24 |
| 9 | PF05195.18 | 1.0 | 36 | 1159.0 | opposite-strand | Aminopeptidase P, N-terminal domain |
| 10 | PF01494.21 | 1.0 | 36 | 2588 | opposite-strand | FAD binding domain |
| 11 | PF00126.29 | 0.92 | 33 | 3180.0 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 12 | PF03466.22 | 0.92 | 33 | 3180.0 | same-strand | LysR substrate binding domain |
++ More..