Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00473 |
NCBI Accession ID | NC_016856.1 |
Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
Left | 3184958 |
Right | 3185077 |
Strand | + |
Nucleotide Sequence | GTGGGCAGTTGTAATTTCCGCAGTAGGGTTGGCTTTTGCGGTATCCGGATGCAGCAGCGATTATGTAATGGCGACGAAAGATGGTCGTATGATCCTGACCGATGGAAAACCACAAGTTGA |
Sequence | VGSCNFRSRVGFCGIRMQQRLCNGDERWSYDPDRWKTTS |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 28122954 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 39 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3165155 | 3165274 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 1759210 | 1759329 | + | NZ_CP033744.1 | Citrobacter freundii |
3 | 3342257 | 3342376 | - | NZ_CP044098.1 | Citrobacter portucalensis |
4 | 3046683 | 3046796 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
5 | 3702095 | 3702217 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
6 | 959567 | 959674 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
7 | 894242 | 894349 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
8 | 906251 | 906358 | - | NZ_CP054254.1 | Klebsiella variicola |
9 | 4341405 | 4341512 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
10 | 5271320 | 5271439 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
11 | 728341 | 728448 | + | NZ_CP026047.1 | Raoultella planticola |
12 | 947140 | 947247 | - | NZ_LR134475.1 | Klebsiella aerogenes |
13 | 890338 | 890445 | - | NZ_CP041247.1 | Raoultella electrica |
14 | 953984 | 954091 | - | NZ_CP014007.2 | Kosakonia oryzae |
15 | 4024988 | 4025095 | - | NZ_CP045300.1 | Kosakonia arachidis |
16 | 861484 | 861591 | - | NZ_CP035129.1 | Kosakonia cowanii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02896.20 | 0.75 | 12 | 2830.5 | opposite-strand | PEP-utilising enzyme, PEP-binding domain |
2 | PF05524.15 | 0.75 | 12 | 2830.5 | opposite-strand | PEP-utilising enzyme, N-terminal |
3 | PF00391.25 | 0.75 | 12 | 2830.5 | opposite-strand | PEP-utilising enzyme, mobile domain |
4 | PF01590.28 | 0.75 | 12 | 2830.5 | opposite-strand | GAF domain |
5 | PF13185.8 | 0.75 | 12 | 2830.5 | opposite-strand | GAF domain |
6 | PF13492.8 | 0.75 | 12 | 2830.5 | opposite-strand | GAF domain |
7 | PF00293.30 | 0.75 | 12 | 2294.0 | opposite-strand | NUDIX domain |
8 | PF02976.17 | 1.0 | 16 | 910.0 | same-strand | DNA mismatch repair enzyme MutH |
9 | PF03741.18 | 0.94 | 15 | 133 | same-strand | Integral membrane protein TerC family |
10 | PF06004.14 | 1.0 | 16 | -107.0 | same-strand | Bacterial protein of unknown function (DUF903) |
11 | PF00248.23 | 1.0 | 16 | 259.5 | same-strand | Aldo/keto reductase family |
12 | PF07690.18 | 0.94 | 15 | 1424 | opposite-strand | Major Facilitator Superfamily |
13 | PF00501.30 | 0.94 | 15 | 2610 | opposite-strand | AMP-binding enzyme |
14 | PF01553.23 | 0.94 | 15 | 2610 | opposite-strand | Acyltransferase |
15 | PF13377.8 | 0.81 | 13 | 5433 | same-strand | Periplasmic binding protein-like domain |
16 | PF00356.23 | 0.81 | 13 | 5433 | same-strand | Bacterial regulatory proteins, lacI family |
17 | PF13407.8 | 0.81 | 13 | 5433 | same-strand | Periplasmic binding protein domain |