Result : EXP00468

Protein Information

• Protein name: EXP00468
• NCBI Accession ID: NC_016856.1
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
• Left: 2980984
• Right: 2981265
• Strand: +
• Nucleotide Sequence: ATGGAAAGCCCTGCATCCCCATCTGCTCCCAGGCCAATAGCGCCCGTTCAAGGATTCGAAGGTCGTTCACCGATAGCTATCCGTGATATTCCGGTGGCTTTTGCATCGGGTTGTAAGGCCGTTTACCCGGCTTTCGCCCCTCCCGCTTATCGTTCTCTCCTGATTTTTTCATGCAGGCACTCACGCTTTTCTCGTCATTCCTGGATTTGCCGCAGGCGGCGCTTTACCGGGCCCAATGTTCCCGCTGACGTCTCAGTCTGCGTATCATTGGTTGCTTTATAG
• Sequence: MESPASPSAPRPIAPVQGFEGRSPIAIRDIPVAFASGCKAVYPAFAPPAYRSLLIFSCRHSRFSRHSWICRRRRFTGPNVPADVSVCVSLVAL
• Source of smORF: Ribo-seq
• Pubmed ID: 28122954
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 93

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2960753	2961034	+	NC_003197.2	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
2	784227	784508	+	NZ_CP053416.1	Salmonella bongori

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_003197.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00268.23	1.0	2	5151.0	same-strand	Ribonucleotide reductase, small chain
2	PF00005.29	1.0	2	3593.5	same-strand	ABC transporter
3	PF00571.30	1.0	2	3593.5	same-strand	CBS domain
4	PF00528.24	1.0	2	2536.5	same-strand	Binding-protein-dependent transport system inner membrane component
5	PF04069.14	1.0	2	1474.0	same-strand	Substrate binding domain of ABC-type glycine betaine transport system
6	PF06779.16	1.0	2	125.0	same-strand	Uncharacterised MFS-type transporter YbfB
7	PF01047.24	1.0	2	91.0	same-strand	MarR family
8	PF12802.9	1.0	2	91.0	same-strand	MarR family
9	PF13463.8	1.0	2	91.0	same-strand	Winged helix DNA-binding domain
10	PF13601.8	1.0	2	91.0	same-strand	Winged helix DNA-binding domain
11	PF00529.22	1.0	2	748.0	same-strand	Cation efflux system protein CusB domain 1
12	PF13533.8	1.0	2	748.0	same-strand	Biotin-lipoyl like
13	PF07690.18	1.0	2	1937.0	same-strand	Major Facilitator Superfamily
14	PF02664.17	1.0	2	4429.0	opposite-strand	S-Ribosylhomocysteinase (LuxS)