Result : EXP00465
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00465 |
| NCBI Accession ID | NC_016856.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 2897891 |
| Right | 2898028 |
| Strand | + |
| Nucleotide Sequence | TTGCGAAACCCAAGGTGCATGCCGAGGGGCGGTTGGCCTCGTAAAAAGCCGCAAAAAAATAGTCGCAAACGACGAAACCTACGCTTTAGCAGCTTAATAACCTGCTTAGAGCCCTCTCTCCCTAGCCTCCGCTCTTAG |
| Sequence | LRNPRCMPRGGWPRKKPQKNSRKRRNLRFSSLITCLEPSLPSLRS |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 28122954 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 69
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2843977 | 2844114 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 2300903 | 2301040 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 3 | 752984 | 753121 | + | NZ_CP053416.1 | Salmonella bongori |
| 4 | 3502102 | 3502239 | + | NZ_CP029736.1 | Providencia rettgeri |
| 5 | 1168931 | 1169050 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 6 | 3682404 | 3682523 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 7 | 4295791 | 4295910 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 8 | 1070519 | 1070638 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 9 | 3416862 | 3416981 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 10 | 641299 | 641418 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 11 | 3345485 | 3345604 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 12 | 3284439 | 3284558 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 13 | 835296 | 835415 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 14 | 102491 | 102610 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 15 | 904534 | 904671 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 16 | 653468 | 653605 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 17 | 2338223 | 2338360 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 18 | 1360058 | 1360195 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 19 | 885411 | 885548 | - | NZ_CP023525.1 | Cedecea neteri |
| 20 | 842523 | 842660 | - | NZ_LR134201.1 | Cedecea lapagei |
| 21 | 1873297 | 1873416 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 22 | 3774559 | 3774678 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 23 | 3523280 | 3523399 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 24 | 876606 | 876725 | - | NZ_CP025799.1 | Dickeya zeae |
| 25 | 840661 | 840780 | - | NZ_LT615367.1 | Dickeya aquatica |
| 26 | 1251106 | 1251225 | - | NZ_CP050508.1 | Raoultella terrigena |
| 27 | 1463681 | 1463800 | + | NZ_CP033744.1 | Citrobacter freundii |
| 28 | 3642198 | 3642317 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 29 | 664461 | 664580 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 30 | 4063776 | 4063913 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 31 | 1581996 | 1582133 | - | NZ_LS483422.1 | Providencia heimbachae |
| 32 | 2607500 | 2607619 | + | NZ_CP028271.1 | Mixta intestinalis |
| 33 | 3463308 | 3463445 | + | NZ_CP026377.1 | Mixta gaviniae |
| 34 | 4006105 | 4006224 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 35 | 4828728 | 4828865 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 36 | 275207 | 275344 | + | NZ_CP065640.1 | Serratia rubidaea |
| 37 | 854705 | 854842 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 38 | 3997223 | 3997360 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 39 | 3310806 | 3310943 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 40 | 1071016 | 1071153 | - | NZ_CP071320.1 | Serratia ureilytica |
| 41 | 511636 | 511755 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 42 | 1292507 | 1292626 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 43 | 946190 | 946309 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 44 | 347169 | 347309 | + | NZ_CP026364.1 | Proteus hauseri |
| 45 | 3039061 | 3039180 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 46 | 2377808 | 2377945 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 47 | 1449456 | 1449575 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 48 | 2503275 | 2503412 | + | NZ_CP067057.1 | Rahnella aceris |
| 49 | 3849417 | 3849536 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 50 | 864602 | 864739 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 51 | 2962392 | 2962529 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 52 | 809478 | 809615 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 53 | 2506427 | 2506564 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 54 | 1193405 | 1193524 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 55 | 1052852 | 1052989 | - | NZ_CP050150.1 | Hafnia alvei |
| 56 | 2638274 | 2638414 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 57 | 271112 | 271249 | + | NZ_CP011254.1 | Serratia fonticola |
| 58 | 3041956 | 3042075 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 59 | 1580995 | 1581114 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 60 | 2009262 | 2009381 | - | NZ_CP014056.2 | Grimontia hollisae |
| 61 | 2547603 | 2547722 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 62 | 812584 | 812703 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 63 | 3192624 | 3192743 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 64 | 567333 | 567455 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 65 | 2653903 | 2654022 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 66 | 3061096 | 3061206 | - | NZ_CP007230.1 | Yersinia similis |
| 67 | 3273213 | 3273335 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 68 | 1295964 | 1296086 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 69 | 1281707 | 1281832 | - | NZ_AP018725.1 | Sulfuriflexus mobilis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP031123.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01668.20 | 0.97 | 67 | 95 | same-strand | SmpB protein |
| 2 | PF02463.21 | 0.7 | 48 | 2068 | same-strand | RecF/RecN/SMC N terminal domain |
| 3 | PF13476.8 | 0.62 | 43 | 2064.5 | same-strand | AAA domain |
| 4 | PF04355.15 | 0.77 | 53 | 1549 | same-strand | SmpA / OmlA family |
| 5 | PF03658.16 | 0.8 | 55 | 1149 | opposite-strand | RnfH family Ubiquitin |
| 6 | PF03364.22 | 0.8 | 55 | 720 | opposite-strand | Polyketide cyclase / dehydrase and lipid transport |
| 7 | PF10604.11 | 0.8 | 55 | 720 | opposite-strand | Polyketide cyclase / dehydrase and lipid transport |
++ More..