Result : B1KJV7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) |
| NCBI Accession ID | CP000961.1 |
| Organism | Shewanella woodyi (strain ATCC 51908 / MS32) |
| Left | 3506068 |
| Right | 3506370 |
| Strand | + |
| Nucleotide Sequence | ATGATAGATACCACTTGGGTCATAATATTAAGCTTCTTGCTCTTCGCCATAGGTACTTTTGGCCTGCTAAGCAGGAGGAACCTGCTTTTTATCTTGCTTTCATTGGAGATCATGTTGAACGGCATCATCTTACTGTTTATAGCGGCATCAAACCTTCACGGAAATAATGACGGCCAGATAATGTACCTATTGGTACTCACTTTAGCCGCATCAGAGGTCGCTGTGGGTCTGGCTTTAGTCGTACAAATCTACAAACAACAACAAAACCTCGATGTCGACACTCTGACTAAGTTGCGAGGCTAA |
| Sequence | MIDTTWVIILSFLLFAIGTFGLLSRRNLLFILLSLEIMLNGIILLFIAASNLHGNNDGQIMYLLVLTLAASEVAVGLALVVQIYKQQQNLDVDTLTKLRG |
| Source of smORF | Swiss-Prot |
| Function | NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. {ECO:0000255|HAMAP-Rule:MF_01456}. |
| Pubmed ID | |
| Domain | CDD:412408 |
| Functional Category | Others |
| Uniprot ID | B1KJV7 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3506068 | 3506370 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 2 | 1868581 | 1868883 | - | NC_014012.1 | Shewanella violacea DSS12 |
| 3 | 4074454 | 4074756 | + | NZ_CP014782.1 | Shewanella psychrophila |
| 4 | 1757220 | 1757522 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 5 | 1704146 | 1704448 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 6 | 127945 | 128211 | + | NZ_CP021435.1 | Halomonas beimenensis |
| 7 | 1439663 | 1439965 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 8 | 170605 | 170907 | - | NZ_CP026047.1 | Raoultella planticola |
| 9 | 1504377 | 1504679 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 10 | 1473681 | 1473983 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 11 | 3772630 | 3772932 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 12 | 1513304 | 1513606 | + | NZ_CP041247.1 | Raoultella electrica |
| 13 | 1523006 | 1523308 | + | NZ_CP054254.1 | Klebsiella variicola |
| 14 | 1575541 | 1575843 | + | NZ_CP050508.1 | Raoultella terrigena |
| 15 | 3478803 | 3479084 | - | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 16 | 730407 | 730709 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 17 | 647028 | 647318 | - | NZ_CP011390.1 | Flavisolibacter tropicus |
| 18 | 2609089 | 2609379 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 19 | 2263836 | 2264099 | + | NZ_CP014234.1 | Moraxella osloensis |
| 20 | 618143 | 618424 | + | NZ_CP016895.1 | Acinetobacter larvae |
| 21 | 2125062 | 2125370 | - | NZ_CP045650.1 | Acinetobacter wanghuae |
| 22 | 853363 | 853644 | + | NZ_CP035934.2 | Acinetobacter cumulans |
| 23 | 571224 | 571508 | + | NZ_CP020465.1 | Cognaticolwellia beringensis |
| 24 | 4787694 | 4787960 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 25 | 541450 | 541743 | - | NZ_CP040449.1 | Aeromonas simiae |
| 26 | 2568996 | 2569304 | + | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 27 | 2254139 | 2254447 | - | NZ_CP053708.1 | Lichenicola cladoniae |
| 28 | 1968069 | 1968350 | - | NZ_AP022188.1 | Aeromonas media |
| 29 | 858746 | 859039 | - | NZ_CP051883.1 | Aeromonas salmonicida |
| 30 | 1943117 | 1943383 | - | NZ_CP050851.1 | Aeromonas hydrophila |
| 31 | 379942 | 380241 | + | NZ_CP015839.1 | Marinobacterium aestuarii |
| 32 | 3044740 | 3044985 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 33 | 3312762 | 3313031 | - | NZ_LN606600.1 | Acetobacter senegalensis |
| 34 | 1220523 | 1220834 | - | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 35 | 2209902 | 2210147 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014012.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01512.19 | 0.97 | 34 | 4898.5 | same-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
| 2 | PF10589.11 | 0.97 | 34 | 4898.5 | same-strand | NADH-ubiquinone oxidoreductase-F iron-sulfur binding region |
| 3 | PF10531.11 | 0.89 | 31 | 4888 | same-strand | SLBB domain |
| 4 | PF13510.8 | 1.0 | 35 | 2099 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 5 | PF04879.18 | 1.0 | 35 | 2099 | same-strand | Molybdopterin oxidoreductase Fe4S4 domain |
| 6 | PF00146.23 | 1.0 | 35 | 1124 | same-strand | NADH dehydrogenase |
| 7 | PF00037.29 | 1.0 | 35 | 564 | same-strand | 4Fe-4S binding domain |
| 8 | PF12838.9 | 1.0 | 35 | 564 | same-strand | 4Fe-4S dicluster domain |
| 9 | PF13237.8 | 1.0 | 35 | 564 | same-strand | 4Fe-4S dicluster domain |
| 10 | PF13187.8 | 1.0 | 35 | 564 | same-strand | 4Fe-4S dicluster domain |
| 11 | PF00499.22 | 1.0 | 35 | 5 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 6 |
| 12 | PF00361.22 | 1.0 | 35 | 1938 | same-strand | Proton-conducting membrane transporter |
| 13 | PF00662.22 | 1.0 | 35 | -3 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
| 14 | PF10588.11 | 0.97 | 34 | 2098.5 | same-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
| 15 | PF00111.29 | 0.86 | 30 | 2099.5 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
++ More..