Result : EXP00459
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00459 |
| NCBI Accession ID | NC_016856.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 2673040 |
| Right | 2673141 |
| Strand | + |
| Nucleotide Sequence | ATGATCAGACGCTTAAAGAGCAACCGCGGGATATCCTGCCTGGGTGATAAGATCACATGCGCGGTTACTAAGATTCCCTCGACCGAATACAAAACCCGATAG |
| Sequence | MIRRLKSNRGISCLGDKITCAVTKIPSTEYKTR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 28122954 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2621487 | 2621588 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 18679 | 18768 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 3 | 1663797 | 1663886 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 4 | 4389907 | 4389996 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 5 | 4192973 | 4193062 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 6 | 2018812 | 2018901 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 7 | 4177386 | 4177475 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 8 | 4768117 | 4768206 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 3418253 | 3418342 | - | NZ_AP014857.1 | Escherichia albertii |
| 10 | 3442246 | 3442335 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 11 | 3426629 | 3426718 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 12 | 2363537 | 2363626 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 13 | 3945435 | 3945524 | - | NZ_LR134340.1 | Escherichia marmotae |
| 14 | 319907 | 319996 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP045205.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01196.21 | 0.92 | 12 | 2247 | same-strand | Ribosomal protein L17 |
| 2 | PF03118.17 | 0.92 | 12 | 1217 | same-strand | Bacterial RNA polymerase, alpha chain C terminal domain |
| 3 | PF01000.28 | 0.92 | 12 | 1217 | same-strand | RNA polymerase Rpb3/RpoA insert domain |
| 4 | PF01193.26 | 0.92 | 12 | 1217 | same-strand | RNA polymerase Rpb3/Rpb11 dimerisation domain |
| 5 | PF00163.21 | 0.92 | 12 | 571 | same-strand | Ribosomal protein S4/S9 N-terminal domain |
| 6 | PF01479.27 | 0.92 | 12 | 571 | same-strand | S4 domain |
| 7 | PF00416.24 | 0.92 | 12 | -89 | same-strand | Ribosomal protein S13/S18 |
| 8 | PF00344.22 | 0.92 | 12 | 431 | same-strand | SecY |
| 9 | PF00828.21 | 0.92 | 12 | 1770 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 10 | PF00327.22 | 0.92 | 12 | 2208 | same-strand | Ribosomal protein L30p/L7e |
| 11 | PF03719.17 | 0.85 | 11 | 2391.0 | same-strand | Ribosomal protein S5, C-terminal domain |
| 12 | PF00333.22 | 0.85 | 11 | 2391.0 | same-strand | Ribosomal protein S5, N-terminal domain |
++ More..