Result : EXP00455
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00455 |
| NCBI Accession ID | NC_016856.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 2147872 |
| Right | 2148093 |
| Strand | + |
| Nucleotide Sequence | ATGTTGACCGGCATTCCGGAACGGCGCTCCAGCACCTCATTAACCCGCGAAGTATCAACGTCATCCCCTTTGATAAACGTGCGCAGCACTGGCGTAACGGGCAATGGAACTTTTTTGTCTGACTCAAATTCAGCACGGTTGCGAGAAAGCGGTTCGTGTACCTCCAGCCAACGACTGCCATCCGGCTCTACCGAAAATTTAACGGGCCTGTCGATAATCTGA |
| Sequence | MLTGIPERRSSTSLTREVSTSSPLINVRSTGVTGNGTFLSDSNSARLRESGSCTSSQRLPSGSTENLTGLSII |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 28122954 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2096318 | 2096539 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 4302188 | 4302397 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 3 | 505107 | 505289 | - | NZ_CP038469.1 | Citrobacter tructae |
| 4 | 1873516 | 1873722 | - | NZ_CP041247.1 | Raoultella electrica |
| 5 | 148122 | 148319 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 6 | 3430177 | 3430359 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 7 | 1722346 | 1722558 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 8 | 3012625 | 3012825 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 9 | 2259487 | 2259687 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 10 | 4344420 | 4344608 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT556085.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01554.20 | 0.6 | 6 | 5058.0 | opposite-strand | MatE |
| 2 | PF17969.3 | 1.0 | 10 | -200.0 | opposite-strand | L,D-transpeptidase C-terminal domain |
| 3 | PF03734.16 | 1.0 | 10 | -200.0 | opposite-strand | L,D-transpeptidase catalytic domain |
| 4 | PF03466.22 | 0.6 | 6 | 1476 | opposite-strand | LysR substrate binding domain |
| 5 | PF00126.29 | 0.6 | 6 | 1476 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
++ More..