ProsmORF-pred
Result : B1KFU3
Protein Information
Information Type Description
Protein name Protein SlyX homolog
NCBI Accession ID CP000961.1
Organism Shewanella woodyi (strain ATCC 51908 / MS32)
Left 1278696
Right 1278908
Strand -
Nucleotide Sequence ATGGAACAATTAGCACAACGAGTCGAAGATCTTGAGATGAAACTGGCTTTTCAGGAGAGCACCATCGATGTCCTTGATCAACAAGTGATCAAGCTCAATGACCTACTTGCAGAGCAGCAGCATCAACTACGCGTTCTTATCAGCAAATTACAAAGTGTAGAACCGAGTAATATGGCGACTCAAGCTGAAGAGACACCACCGCCACACTATTAA
Sequence MEQLAQRVEDLEMKLAFQESTIDVLDQQVIKLNDLLAEQQHQLRVLISKLQSVEPSNMATQAEETPPPHY
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl01090. Profile Description: SlyX. hypothetical protein; Provisional
Pubmed ID
Domain CDD:412736
Functional Category Others
Uniprot ID B1KFU3
ORF Length (Amino Acid) 70
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 61
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1278696 1278908 - NC_010506.1 Shewanella woodyi ATCC 51908
2 1097514 1097726 - NC_009831.1 Shewanella sediminis HAW-EB3
3 3463850 3464026 + NZ_CP022272.1 Shewanella marisflavi
4 2971717 2971929 + NZ_CP014782.1 Shewanella psychrophila
5 961672 961848 - NC_009092.1 Shewanella loihica PV-4
6 4069936 4070148 + NZ_CP020472.1 Shewanella japonica
7 1026006 1026218 - NC_009901.1 Shewanella pealeana ATCC 700345
8 4182096 4182308 + NC_016901.1 Shewanella baltica OS678
9 570817 571029 - NZ_CP037952.1 Parashewanella spongiae
10 3718429 3718641 + NZ_CP022358.1 Shewanella bicestrii
11 2340369 2340581 + NZ_CP041783.1 Shewanella donghaensis
12 3190834 3191046 - NZ_CP036200.1 Shewanella maritima
13 3586829 3587041 + NZ_CP037951.1 Parashewanella tropica
14 4263899 4264111 + NZ_CP034015.1 Shewanella livingstonensis
15 3877704 3877916 + NC_008345.1 Shewanella frigidimarina NCIMB 400
16 3875284 3875496 + NZ_CP041036.1 Shewanella polaris
17 3475533 3475745 + NC_007954.1 Shewanella denitrificans OS217
18 795983 796186 - NC_008700.1 Shewanella amazonensis SB2B
19 675237 675440 - NZ_CP069213.1 Shewanella litorisediminis
20 3825837 3826049 + NZ_CP046378.1 Shewanella algae
21 881918 882130 - NC_011566.1 Shewanella piezotolerans WP3
22 895582 895791 - NC_014012.1 Shewanella violacea DSS12
23 1099194 1099406 - NC_010334.1 Shewanella halifaxensis HAW-EB4
24 213177 213401 - NZ_CP020373.1 Shewanella khirikhana
25 1642888 1643058 + NZ_LT906448.1 Pasteurella dagmatis
26 1306729 1306905 + NZ_LR134327.1 Aggregatibacter aphrophilus ATCC 33389
27 2127553 2127729 + NZ_CP018804.1 Histophilus somni
28 371193 371369 + NZ_LS483443.1 Aggregatibacter segnis ATCC 33393
29 40622 40798 - NZ_CP016605.1 Bisgaardia hudsonensis
30 508514 508684 + NZ_CP015029.1 Frederiksenia canicola
31 431932 432150 - NC_012880.1 Musicola paradisiaca Ech703
32 409734 409940 - NZ_LN907827.1 Erwinia gerundensis
33 183076 183279 - NZ_CP009056.1 Frischella perrara
34 441655 441825 - NZ_LR134167.1 Avibacterium volantium
35 1666894 1667106 + NZ_CP015137.1 Dickeya solani IPO 2222
36 4209357 4209542 + NZ_CP025799.1 Dickeya zeae
37 447521 447712 - NZ_CP045845.1 Kluyvera intermedia
38 465724 465906 - NZ_CP026377.1 Mixta gaviniae
39 4404189 4404401 + NC_014500.1 Dickeya dadantii 3937
40 4159507 4159734 + NZ_CP034752.1 Jinshanibacter zhutongyuii
41 460044 460262 - NZ_CP042220.2 Dickeya poaceiphila
42 363240 363425 - NC_012912.1 Dickeya chrysanthemi Ech1591
43 444708 444926 - NZ_CP045720.1 Pantoea eucalypti
44 391114 391296 - NZ_CP061511.1 Mixta calida
45 3626643 3626861 + NZ_CP034148.1 Pantoea agglomerans
46 806873 807064 - NZ_LR134510.1 Actinobacillus delphinicola
47 2085804 2086025 + NZ_CP009159.1 Actinobacillus suis ATCC 33415
48 3344919 3345089 + NZ_CP029185.2 Limnobaculum parvum
49 1200132 1200323 + NZ_CP019706.1 Pantoea alhagi
50 2034572 2034793 - NZ_CP007715.1 Actinobacillus equuli subsp. equuli
51 4725304 4725507 - NC_013716.1 Citrobacter rodentium ICC168
52 3547461 3547679 - NZ_CP045300.1 Kosakonia arachidis
53 439835 440053 - NZ_CP014007.2 Kosakonia oryzae
54 4359954 4360130 - NZ_CP046670.1 Alteromonas mediterranea
55 3605931 3606134 + NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
56 3965737 3965940 + NZ_LR134340.1 Escherichia marmotae
57 2383838 2384041 + NZ_CP057657.1 Escherichia fergusonii
58 3438559 3438762 + NZ_AP014857.1 Escherichia albertii
59 4360951 4361154 + NC_009792.1 Citrobacter koseri ATCC BAA-895
60 39118 39321 + NZ_CP045205.1 Citrobacter telavivensis
61 299949 300167 - NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_010506.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00254.30 1.0 61 244.0 opposite-strand FKBP-type peptidyl-prolyl cis-trans isomerase
2 PF01346.20 0.98 60 283.5 opposite-strand Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
++ More..