Result : B1IJL2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0291 protein CLD_1956 |
| NCBI Accession ID | CP000939.1 |
| Organism | Clostridium botulinum (strain Okra / Type B1) |
| Left | 2790027 |
| Right | 2790215 |
| Strand | - |
| Nucleotide Sequence | ATGGACATGAAAAAACTTATAGAGAGAATTAATTTTTTATATAAAAAAAGTAAAGAAGAAGGACTTACAAAAGAAGAAAAAGTAGAACAGCAAAAACTAAGAAGAGAATACATAGATATAATAAAGGGAAATGTGAAGGTTCAATTAGAAGGAGTAGAAAAGATACCAACGCCTAATAGAAAAAACTAA |
| Sequence | MDMKKLIERINFLYKKSKEEGLTKEEKVEQQKLRREYIDIIKGNVKVQLEGVEKIPTPNRKN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 18060065 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | B1IJL2 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2705309 | 2705497 | - | NZ_CP028842.1 | Clostridium botulinum |
| 2 | 2941308 | 2941496 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 3 | 2852879 | 2853046 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 4 | 2440979 | 2441164 | - | NZ_CP014176.1 | Clostridium argentinense |
| 5 | 2652605 | 2652793 | + | NZ_CP020953.1 | Clostridium drakei |
| 6 | 1682373 | 1682561 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 7 | 1601282 | 1601470 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 8 | 2471223 | 2471420 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 9 | 1875554 | 1875742 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 10 | 1421948 | 1422136 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 11 | 1661409 | 1661588 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 12 | 2374903 | 2375076 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 13 | 2575963 | 2576157 | - | NZ_CP040924.1 | Clostridium thermarum |
| 14 | 298872 | 299087 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 15 | 379104 | 379277 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 16 | 641943 | 642134 | + | NZ_CP016786.1 | Clostridium isatidis |
| 17 | 1719427 | 1719615 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 18 | 306320 | 306502 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 19 | 2393326 | 2393508 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 20 | 857674 | 857844 | + | NZ_CP014204.2 | Clostridium baratii |
| 21 | 3384835 | 3385023 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 22 | 4789314 | 4789511 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 23 | 2080435 | 2080638 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 24 | 2059121 | 2059294 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 25 | 1609173 | 1609370 | + | NZ_CP043998.1 | Clostridium diolis |
| 26 | 1870319 | 1870501 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 27 | 5544171 | 5544353 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 28 | 2931911 | 2932099 | + | NZ_CP023671.1 | Clostridium septicum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028842.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07475.14 | 0.64 | 18 | 18.0 | same-strand | HPr Serine kinase C-terminal domain |
| 2 | PF02603.18 | 0.64 | 18 | 18.0 | same-strand | HPr Serine kinase N terminus |
++ More..