Result : EXP00438
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00438 |
| NCBI Accession ID | NC_016856.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 1138794 |
| Right | 1138979 |
| Strand | + |
| Nucleotide Sequence | TTGAAAAGAACAACGTGCTTATATACCTCCTGGGTTTTTGCCGCTTTTGTCTCTCTGCTGATATTTGCCTGGAGTGTCATAAACTATCCTCTCTATGAATCCATAATAATTATTGTCTTTTATATCTGGCTAATTCTGGTACCGCTTTATCTTATTGTGTATGAGTGGCTAATAGATTGTCATTAA |
| Sequence | LKRTTCLYTSWVFAAFVSLLIFAWSVINYPLYESIIIIVFYIWLILVPLYLIVYEWLIDCH |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 28122954 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1180438 | 1180623 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 3575134 | 3575319 | + | NZ_CP053416.1 | Salmonella bongori |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07824.14 | 1.0 | 2 | 2225.0 | opposite-strand | Type III secretion chaperone domain |
| 2 | PF05925.14 | 1.0 | 2 | 525.0 | opposite-strand | Enterobacterial virulence protein IpgD |
| 3 | PF03577.17 | 1.0 | 2 | 3.0 | opposite-strand | Peptidase family C69 |
| 4 | PF02518.28 | 1.0 | 2 | 1641.0 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 5 | PF00512.27 | 1.0 | 2 | 1641.0 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 6 | PF00672.27 | 1.0 | 2 | 1641.0 | opposite-strand | HAMP domain |
| 7 | PF14501.8 | 1.0 | 2 | 1641.0 | opposite-strand | GHKL domain |
| 8 | PF00072.26 | 1.0 | 2 | 2996.5 | opposite-strand | Response regulator receiver domain |
| 9 | PF00486.30 | 1.0 | 2 | 2996.5 | opposite-strand | Transcriptional regulatory protein, C terminal |
| 10 | PF00576.23 | 1.0 | 2 | 3812.5 | same-strand | HIUase/Transthyretin family |
| 11 | PF01613.20 | 1.0 | 2 | 4451.0 | opposite-strand | Flavin reductase like domain |
++ More..