Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00430 |
NCBI Accession ID | NC_016856.1 |
Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
Left | 540761 |
Right | 540868 |
Strand | + |
Nucleotide Sequence | ATGAAAAGCAACAAAAGCGCTGAAGCACACGAATCGCTGTTGCAATTGTCGTTCACAGCCAGTAAATTCGACCGTTTTCGAGCACAGGCGCAGGCGGTCAAAGAGTAA |
Sequence | MKSNKSAEAHESLLQLSFTASKFDRFRAQAQAVKE |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 28122954 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 35 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 540070 | 540177 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 3071523 | 3071630 | + | NZ_CP053416.1 | Salmonella bongori |
3 | 1136119 | 1136226 | + | NZ_LR134340.1 | Escherichia marmotae |
4 | 1596886 | 1596993 | - | NZ_CP057657.1 | Escherichia fergusonii |
5 | 1109743 | 1109850 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
6 | 1307938 | 1308045 | + | NZ_CP043318.1 | Enterobacter chengduensis |
7 | 1067667 | 1067774 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
8 | 3627890 | 3627997 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
9 | 3171409 | 3171516 | + | NZ_CP061527.1 | Shigella dysenteriae |
10 | 2460696 | 2460803 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
11 | 557133 | 557240 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
12 | 509237 | 509344 | + | NZ_AP014857.1 | Escherichia albertii |
13 | 491237 | 491344 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
14 | 427768 | 427875 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
15 | 17765 | 17875 | + | NZ_CP023529.1 | Lelliottia amnigena |
16 | 1116948 | 1117055 | + | NZ_AP022508.1 | Enterobacter bugandensis |
17 | 2875585 | 2875692 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
18 | 1165081 | 1165188 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
19 | 1441030 | 1441137 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
20 | 3362251 | 3362361 | - | NZ_CP011602.1 | Phytobacter ursingii |
21 | 4591845 | 4591955 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
22 | 1170719 | 1170826 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
23 | 1074073 | 1074180 | + | NZ_LR134201.1 | Cedecea lapagei |
24 | 3458144 | 3458251 | - | NZ_CP035129.1 | Kosakonia cowanii |
25 | 3422722 | 3422820 | - | NZ_AP023184.1 | Buttiauxella agrestis |
26 | 1120969 | 1121076 | + | NZ_CP023525.1 | Cedecea neteri |
27 | 1171250 | 1171357 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
28 | 1890913 | 1891023 | - | NZ_CP016337.1 | Kosakonia sacchari |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12794.9 | 1.0 | 27 | 1158.5 | same-strand | Mechanosensitive ion channel inner membrane domain 1 |
2 | PF00924.20 | 1.0 | 27 | 1158.5 | same-strand | Mechanosensitive ion channel |
3 | PF12795.9 | 1.0 | 27 | 1158.5 | same-strand | Mechanosensitive ion channel porin domain |
4 | PF10689.11 | 1.0 | 27 | 964.0 | opposite-strand | Protein of unknown function (DUF2496) |
5 | PF07445.14 | 1.0 | 27 | 422.0 | opposite-strand | Primosomal replication protein priC |
6 | PF04304.15 | 1.0 | 27 | -22.0 | same-strand | Protein of unknown function (DUF454) |
7 | PF12170.10 | 1.0 | 27 | 731.0 | same-strand | DNA polymerase III tau subunit V interacting with alpha |
8 | PF13177.8 | 1.0 | 27 | 731.0 | same-strand | DNA polymerase III, delta subunit |
9 | PF12169.10 | 1.0 | 27 | 731.0 | same-strand | DNA polymerase III subunits gamma and tau domain III |
10 | PF12168.10 | 1.0 | 27 | 731.0 | same-strand | DNA polymerase III subunits tau domain IV DnaB-binding |
11 | PF00004.31 | 1.0 | 27 | 731.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
12 | PF13401.8 | 0.93 | 25 | 730.5 | same-strand | AAA domain |
13 | PF02575.18 | 1.0 | 27 | 2729.0 | same-strand | YbaB/EbfC DNA-binding family |
14 | PF13662.8 | 0.89 | 24 | 3055 | same-strand | Toprim domain |
15 | PF02132.17 | 0.89 | 24 | 3055 | same-strand | RecR protein |
16 | PF01751.24 | 0.89 | 24 | 3055 | same-strand | Toprim domain |
17 | PF00183.20 | 0.89 | 24 | 3776 | same-strand | Hsp90 protein |
18 | PF02518.28 | 0.89 | 24 | 3776 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
19 | PF13589.8 | 0.89 | 24 | 3776 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
20 | PF08361.13 | 0.93 | 25 | 4642.5 | same-strand | MAATS-type transcriptional repressor, C-terminal region |
21 | PF00440.25 | 0.93 | 25 | 4642.5 | same-strand | Bacterial regulatory proteins, tetR family |