Result : EXP00428
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00428 |
| NCBI Accession ID | NC_016856.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 442306 |
| Right | 442398 |
| Strand | + |
| Nucleotide Sequence | ATGAACCACTCGGAAGGGATTCTGAGTACCCCTAAATTGTATCTCCATCACATTCTTGAAACATTTATACTGGCAACTAAAACCGTAAATTAA |
| Sequence | MNHSEGILSTPKLYLHHILETFILATKTVN |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 28122954 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 30 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 441614 | 441706 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 2982785 | 2982877 | + | NZ_CP053416.1 | Salmonella bongori |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00990.23 | 1.0 | 2 | 2372.0 | same-strand | Diguanylate cyclase, GGDEF domain |
| 2 | PF05230.13 | 1.0 | 2 | 2372.0 | same-strand | MASE2 domain |
| 3 | PF14748.8 | 1.0 | 2 | 1548.0 | opposite-strand | Pyrroline-5-carboxylate reductase dimerisation |
| 4 | PF03807.19 | 1.0 | 2 | 1548.0 | opposite-strand | NADP oxidoreductase coenzyme F420-dependent |
| 5 | PF02639.16 | 1.0 | 2 | 953.0 | same-strand | Uncharacterized BCR, YaiI/YqxD family COG1671 |
| 6 | PF01202.24 | 1.0 | 2 | 223.0 | same-strand | Shikimate kinase |
| 7 | PF13238.8 | 1.0 | 2 | 223.0 | same-strand | AAA domain |
| 8 | PF16362.7 | 1.0 | 2 | 5.0 | same-strand | YaiA protein |
| 9 | PF07302.13 | 1.0 | 2 | 155.5 | same-strand | AroM protein |
| 10 | PF06865.13 | 1.0 | 2 | 903.5 | same-strand | Pyrimidine/purine nucleoside phosphorylase |
| 11 | PF04381.14 | 1.0 | 2 | 1225.0 | opposite-strand | Putative exonuclease, RdgC |
| 12 | PF00480.22 | 1.0 | 2 | 2262.0 | same-strand | ROK family |
| 13 | PF07690.18 | 1.0 | 2 | 3194.5 | opposite-strand | Major Facilitator Superfamily |
++ More..