Result : EXP00425
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00425 |
| NCBI Accession ID | NC_016856.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 337324 |
| Right | 337587 |
| Strand | + |
| Nucleotide Sequence | ATGCTAAATAAATTTAAATTGTGGGTGAGCAAACATACTGATTATACGGTAATTCATAATGAAAATGATTTATCTTACAGTATTATTATAGATTTTGAAGATGACCGGTATATATCAAGATTTACTGTATGGGATGACCTAAGCTGTATGTCAGAAGTAATGGATGTGGATACTGGTTTATATAAATTAAACAAGAGAAACGAATTTTCTACATTTGATGAACTTCTGGATATATTTGATGATTTTATGATAAGTATTAAATAA |
| Sequence | MLNKFKLWVSKHTDYTVIHNENDLSYSIIIDFEDDRYISRFTVWDDLSCMSEVMDVDTGLYKLNKRNEFSTFDELLDIFDDFMISIK |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 28122954 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 336640 | 336903 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 1191606 | 1191869 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 3 | 73924 | 74193 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05954.13 | 0.67 | 2 | 3687.0 | same-strand | Phage tail baseplate hub (GPD) |
| 2 | PF04717.14 | 0.67 | 2 | 3687.0 | same-strand | Type VI secretion system/phage-baseplate injector OB domain |
| 3 | PF08786.13 | 1.0 | 3 | 4725 | same-strand | DcrB |
| 4 | PF05593.16 | 1.0 | 3 | 1489 | same-strand | RHS Repeat |
| 5 | PF20148.1 | 1.0 | 3 | 1489 | same-strand | Domain of unknown function (DUF6531) |
| 6 | PF05488.15 | 0.67 | 2 | 741.5 | same-strand | PAAR motif |
| 7 | PF03527.16 | 1.0 | 3 | 1489 | same-strand | RHS protein |
| 8 | PF15428.8 | 0.67 | 2 | 1254.5 | same-strand | Immunity protein 26 |
++ More..