Result : EXP00422
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00422 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 4066239 |
| Right | 4066460 |
| Strand | - |
| Nucleotide Sequence | GTGAAAACCGCAGACAGCGGTTCGTGCGTCACCCTTCATGCAGGGTCTTATCGACGTGCGCCAACAATCATTAATGTATCAGCCTTTGTCATTTATCGACTTTTGTTCGAGTGGAGTCCGCCGTGTCACTTTCGCTTTGGCAGCAGTGTCTTGCCCGATTGCAGGATGAGTTACCAGCCACAGAATTCAGTATGTGGATACGCCCGTTGCAGGCGGAACTGA |
| Sequence | VKTADSGSCVTLHAGSYRRAPTIINVSAFVIYRLLFEWSPPCHFRFGSSVLPDCRMSYQPQNSVCGYARCRRN |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1854339 | 1854560 | - | NZ_CP053416.1 | Salmonella bongori |
| 2 | 4044938 | 4045159 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 3 | 2419204 | 2419440 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 4 | 2665594 | 2665830 | - | NZ_CP033744.1 | Citrobacter freundii |
| 5 | 1721542 | 1721748 | - | NZ_CP026047.1 | Raoultella planticola |
| 6 | 301 | 507 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 7 | 381 | 560 | + | NC_015968.1 | Enterobacter soli |
| 8 | 5299510 | 5299695 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 9 | 1279945 | 1280142 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 10 | 3773997 | 3774224 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 11 | 4026777 | 4026980 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 12 | 82623 | 82814 | + | NZ_CP006569.1 | Sodalis praecaptivus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP053416.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08282.14 | 0.83 | 10 | 6278.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 2 | PF00204.27 | 0.92 | 11 | 3654 | same-strand | DNA gyrase B |
| 3 | PF18053.3 | 0.92 | 11 | 3654 | same-strand | DNA gyrase B subunit insert domain |
| 4 | PF00986.23 | 0.92 | 11 | 3654 | same-strand | DNA gyrase B subunit, carboxyl terminus |
| 5 | PF02518.28 | 0.92 | 11 | 3654 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 6 | PF01751.24 | 0.92 | 11 | 3654 | same-strand | Toprim domain |
| 7 | PF02463.21 | 0.92 | 11 | 2552 | same-strand | RecF/RecN/SMC N terminal domain |
| 8 | PF00712.21 | 0.92 | 11 | 1306 | same-strand | DNA polymerase III beta subunit, N-terminal domain |
| 9 | PF02767.18 | 0.92 | 11 | 1306 | same-strand | DNA polymerase III beta subunit, central domain |
| 10 | PF02768.17 | 0.92 | 11 | 1306 | same-strand | DNA polymerase III beta subunit, C-terminal domain |
| 11 | PF00308.20 | 0.92 | 11 | -99 | same-strand | Bacterial dnaA protein |
| 12 | PF08299.13 | 0.92 | 11 | -99 | same-strand | Bacterial dnaA protein helix-turn-helix |
| 13 | PF11638.10 | 1.0 | 12 | -99.0 | same-strand | DnaA N-terminal domain |
| 14 | PF00004.31 | 0.92 | 11 | -99.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 15 | PF14849.8 | 0.83 | 10 | 1272.0 | opposite-strand | YidC periplasmic domain |
| 16 | PF02096.22 | 0.83 | 10 | 1272.0 | opposite-strand | 60Kd inner membrane protein |
| 17 | PF12631.9 | 0.83 | 10 | 3023.5 | opposite-strand | MnmE helical domain |
| 18 | PF10396.11 | 0.83 | 10 | 3023.5 | opposite-strand | GTP-binding protein TrmE N-terminus |
++ More..