Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00421 |
NCBI Accession ID | NC_016810.1 |
Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
Left | 4026854 |
Right | 4026949 |
Strand | - |
Nucleotide Sequence | ATGCGCTGTGGCCCGGCCATCCCCGCCAGAGCTGATGGCTCCAGTCGAATTCCTTCCTCCTGCGCCAGCCAGCCCAGCATGTCATACATTGTTTGA |
Sequence | MRCGPAIPARADGSSRIPSSCASQPSMSYIV |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | Venturini et al 2020 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 31 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4005553 | 4005648 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 4602432 | 4602533 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
3 | 2562767 | 2562844 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
4 | 3546746 | 3546844 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
5 | 25332 | 25424 | + | NZ_CP043318.1 | Enterobacter chengduensis |
6 | 74561 | 74653 | + | NZ_CP060111.1 | Klebsiella michiganensis |
7 | 23577 | 23669 | + | NZ_AP022508.1 | Enterobacter bugandensis |
8 | 23942 | 24034 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
9 | 25222 | 25299 | + | NZ_CP009756.1 | Enterobacter cloacae |
10 | 3509388 | 3509465 | + | NZ_CP023529.1 | Lelliottia amnigena |
11 | 3258258 | 3258335 | + | NZ_CP017279.1 | Enterobacter ludwigii |
12 | 4749481 | 4749576 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
13 | 21612 | 21716 | + | NC_015968.1 | Enterobacter soli |
14 | 1626236 | 1626313 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
15 | 23772 | 23864 | + | NZ_CP050508.1 | Raoultella terrigena |
16 | 2642413 | 2642490 | - | NZ_CP033744.1 | Citrobacter freundii |
17 | 5208883 | 5208960 | + | NZ_CP023525.1 | Cedecea neteri |
18 | 502874 | 502981 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
19 | 4632673 | 4632765 | + | NZ_CP011602.1 | Phytobacter ursingii |
20 | 2972715 | 2972819 | + | NC_012962.1 | Photorhabdus asymbiotica |
21 | 2082377 | 2082472 | - | NZ_CP051883.1 | Aeromonas salmonicida |
22 | 4047095 | 4047172 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
23 | 1560950 | 1561027 | + | NZ_CP050851.1 | Aeromonas hydrophila |
24 | 2652987 | 2653097 | + | NZ_CP038662.1 | Serratia nematodiphila |
25 | 3228574 | 3228687 | - | NZ_CP031123.2 | Providencia huaxiensis |
26 | 1341760 | 1341873 | + | NZ_CP029736.1 | Providencia rettgeri |
27 | 988031 | 988138 | + | NC_017554.1 | Pantoea ananatis PA13 |
28 | 886272 | 886361 | + | NZ_AP019652.1 | Vibrio taketomensis |
29 | 2704293 | 2704385 | + | NZ_LT906479.1 | Serratia ficaria |
30 | 1926840 | 1926950 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
31 | 1899881 | 1899985 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07690.18 | 0.61 | 19 | 4641 | opposite-strand | Major Facilitator Superfamily |
2 | PF03466.22 | 0.74 | 23 | 2656.0 | same-strand | LysR substrate binding domain |
3 | PF00126.29 | 0.74 | 23 | 2656.0 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
4 | PF02447.18 | 0.65 | 20 | 1108.5 | opposite-strand | GntP family permease |
5 | PF03600.18 | 0.65 | 20 | 1108.5 | opposite-strand | Citrate transporter |
6 | PF00291.27 | 1.0 | 31 | -92 | opposite-strand | Pyridoxal-phosphate dependent enzyme |