Result : B1I6L4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L31 |
| NCBI Accession ID | CP000860.1 |
| Organism | Desulforudis audaxviator (strain MP104C) |
| Left | 2271257 |
| Right | 2271460 |
| Strand | - |
| Nucleotide Sequence | ATGAAGGAAAAGCTTCACCCGGCCTACCAGAAGGCCAGGATAGTGTGTGTGTGCGGGGCCCAGTTCGAGGTTGGATCCACCAAGAAGGAAATGCGCGTGGACATCTGCTCGAAGTGTCACCCCTTTTACACCGGCATGCAGCGCACGGTGGAGACCCGCGGCCGCGCCGACAAGTTCCGCCGCAAGTACGGTCTTGGCAAGTAG |
| Sequence | MKEKLHPAYQKARIVCVCGAQFEVGSTKKEMRVDICSKCHPFYTGMQRTVETRGRADKFRRKYGLGK |
| Source of smORF | Swiss-Prot |
| Function | Binds the 23S rRNA. {ECO:0000255|HAMAP-Rule:MF_00501}. |
| Pubmed ID | |
| Domain | CDD:412343 |
| Functional Category | Metal-binding_and_Ribosomal_protein |
| Uniprot ID | B1I6L4 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 376
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2285452 | 2285649 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 2 | 4712956 | 4713156 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 3 | 3451340 | 3451540 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 4 | 3203959 | 3204156 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 5 | 3773072 | 3773272 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 6 | 3105812 | 3106012 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 7 | 4546456 | 4546659 | - | NZ_CP039126.1 | Blautia producta |
| 8 | 899731 | 899928 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 9 | 2444928 | 2445131 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 10 | 2769335 | 2769538 | - | NZ_CP030280.1 | Blautia argi |
| 11 | 2962476 | 2962676 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 12 | 1905394 | 1905597 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 13 | 3552442 | 3552639 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 14 | 1499418 | 1499624 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 15 | 2276353 | 2276556 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 16 | 798777 | 798980 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 17 | 4222048 | 4222245 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 18 | 808927 | 809136 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 19 | 683470 | 683676 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 20 | 5154332 | 5154529 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 21 | 2484924 | 2485124 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 22 | 2475115 | 2475315 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 23 | 3211552 | 3211752 | + | NZ_CP070062.1 | Coprococcus comes |
| 24 | 3913377 | 3913586 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 25 | 3326503 | 3326703 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 26 | 2379546 | 2379752 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 27 | 129433 | 129636 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 28 | 2729628 | 2729831 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 29 | 7221504 | 7221701 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 30 | 2840416 | 2840631 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 31 | 5772552 | 5772749 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 32 | 2797313 | 2797513 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 33 | 881824 | 882024 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 34 | 3358178 | 3358378 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 35 | 68058 | 68261 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 36 | 3703787 | 3703996 | - | NZ_CP036259.1 | Sporomusa termitida |
| 37 | 486633 | 486842 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 38 | 21733 | 21951 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 39 | 2558640 | 2558843 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 40 | 54487 | 54687 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 41 | 904624 | 904821 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 42 | 3026461 | 3026664 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 43 | 3111167 | 3111364 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 44 | 2092875 | 2093105 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 45 | 4852284 | 4852481 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 46 | 738095 | 738295 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 47 | 189613 | 189819 | + | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 48 | 4520708 | 4520917 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 49 | 3047926 | 3048123 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 50 | 3245455 | 3245652 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 51 | 2371960 | 2372157 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 52 | 339543 | 339743 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 53 | 4041043 | 4041240 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 54 | 2320836 | 2321039 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 55 | 622036 | 622239 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 56 | 26190 | 26390 | + | NZ_CP029256.1 | Christensenella minuta |
| 57 | 4499685 | 4499897 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 58 | 3220972 | 3221172 | - | NZ_CP012024.1 | Bacillus smithii |
| 59 | 696028 | 696237 | - | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 60 | 4786999 | 4787196 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 61 | 4033270 | 4033476 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 62 | 169874 | 170074 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 63 | 4753705 | 4753914 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 64 | 4896706 | 4896915 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 65 | 2002349 | 2002549 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 66 | 3353063 | 3353263 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 67 | 1945318 | 1945518 | + | NZ_CP043404.1 | Bacillus safensis |
| 68 | 3779828 | 3780028 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 69 | 3985905 | 3986105 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 70 | 2448990 | 2449190 | + | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 71 | 2208820 | 2209029 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 72 | 266170 | 266382 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 73 | 4466549 | 4466746 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 74 | 2920631 | 2920837 | - | NZ_CP048436.1 | Flavonifractor plautii |
| 75 | 8231047 | 8231259 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 76 | 3419559 | 3419759 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 77 | 2520105 | 2520305 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 78 | 2082400 | 2082606 | - | NZ_LR699011.1 | Roseburia hominis |
| 79 | 3675417 | 3675617 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 80 | 3635783 | 3635983 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 81 | 3617518 | 3617718 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 82 | 3630212 | 3630412 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 83 | 3692316 | 3692516 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 84 | 2435776 | 2435976 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 85 | 3803081 | 3803281 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 86 | 2581312 | 2581512 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 87 | 2163128 | 2163334 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 88 | 3661865 | 3662065 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 89 | 1921131 | 1921349 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 90 | 398699 | 398899 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 91 | 2083056 | 2083265 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 92 | 651210 | 651416 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 93 | 2792175 | 2792372 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 94 | 2865534 | 2865734 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 95 | 2607271 | 2607471 | - | NZ_CP034118.1 | Staphylospora marina |
| 96 | 384128 | 384328 | + | NZ_CP011937.1 | Bacillus velezensis |
| 97 | 3467425 | 3467622 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 98 | 585451 | 585651 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 99 | 125567 | 125767 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 100 | 356468 | 356665 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 101 | 2660848 | 2661048 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 102 | 472049 | 472252 | - | NZ_CP060715.1 | Erysipelothrix inopinata |
| 103 | 3756208 | 3756405 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 104 | 2234794 | 2235000 | - | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 105 | 1525223 | 1525438 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 106 | 2296884 | 2297093 | - | NZ_LN879430.1 | Herbinix luporum |
| 107 | 4211729 | 4211929 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 108 | 798248 | 798454 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 109 | 4659680 | 4659889 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 110 | 675179 | 675385 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 111 | 4325430 | 4325639 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 112 | 211739 | 211936 | + | NZ_CP009687.1 | Clostridium aceticum |
| 113 | 501558 | 501764 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 114 | 2994656 | 2994856 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 115 | 3501107 | 3501307 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 116 | 7282609 | 7282818 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 117 | 2774062 | 2774265 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 118 | 1022074 | 1022289 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 119 | 4178808 | 4179032 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 120 | 851427 | 851624 | + | NZ_LR134375.1 | Veillonella dispar |
| 121 | 2634340 | 2634543 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 122 | 940318 | 940515 | + | NZ_LR778174.1 | Veillonella parvula |
| 123 | 1690487 | 1690690 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 124 | 1226191 | 1226391 | + | NC_012115.1 | Nautilia profundicola AmH |
| 125 | 2422757 | 2422960 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 126 | 321808 | 322008 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 127 | 192391 | 192591 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 128 | 1251793 | 1251990 | - | NZ_LT906470.1 | Veillonella rodentium |
| 129 | 358616 | 358819 | + | NZ_LT632322.1 | Murdochiella vaginalis |
| 130 | 1958982 | 1959209 | + | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 131 | 993433 | 993642 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 132 | 136000 | 136197 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 133 | 846167 | 846364 | + | NZ_AP022321.1 | Veillonella nakazawae |
| 134 | 5068402 | 5068599 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 135 | 1476986 | 1477186 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 136 | 197135 | 197332 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 137 | 277860 | 278072 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 138 | 2136929 | 2137129 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 139 | 2007519 | 2007719 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 140 | 841346 | 841546 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 141 | 240665 | 240877 | + | NC_022549.1 | Acholeplasma brassicae |
| 142 | 1876431 | 1876631 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 143 | 1279501 | 1279701 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 144 | 248218 | 248427 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 145 | 7255633 | 7255845 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 146 | 1756846 | 1757049 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 147 | 45504 | 45713 | - | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 148 | 8491409 | 8491606 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 149 | 2553493 | 2553708 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 150 | 2621315 | 2621530 | - | NZ_CP016538.2 | Planococcus maritimus |
| 151 | 2642599 | 2642814 | - | NZ_CP059540.1 | Planococcus maritimus |
| 152 | 2436170 | 2436385 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 153 | 2757753 | 2757953 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 154 | 1607189 | 1607392 | + | NC_015578.1 | Treponema primitia ZAS-2 |
| 155 | 465577 | 465777 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 156 | 3434711 | 3434911 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 157 | 3343321 | 3343518 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 158 | 1455240 | 1455443 | - | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 159 | 1119534 | 1119740 | + | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 160 | 456861 | 457058 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 161 | 2372338 | 2372544 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 162 | 6144068 | 6144268 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 163 | 3802585 | 3802785 | - | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 164 | 967991 | 968206 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 165 | 522673 | 522876 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 166 | 4909024 | 4909224 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 167 | 3253272 | 3253478 | - | NC_014624.2 | Eubacterium callanderi |
| 168 | 4116971 | 4117177 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 169 | 1929519 | 1929725 | + | NZ_CP019962.1 | Eubacterium limosum |
| 170 | 2415214 | 2415435 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 171 | 3341649 | 3341852 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 172 | 536619 | 536840 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 173 | 3020862 | 3021074 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 174 | 2513065 | 2513286 | - | NZ_CP011391.1 | Faecalibaculum rodentium |
| 175 | 133912 | 134109 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 176 | 288246 | 288446 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 177 | 3248732 | 3248953 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 178 | 1924311 | 1924517 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 179 | 3131743 | 3131943 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
| 180 | 2454466 | 2454681 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 181 | 3919910 | 3920107 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 182 | 716973 | 717182 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 183 | 2264010 | 2264210 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 184 | 3043223 | 3043438 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 185 | 69811 | 70035 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 186 | 723811 | 724020 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 187 | 2233108 | 2233317 | + | NC_008593.1 | Clostridium novyi NT |
| 188 | 4938551 | 4938751 | - | NZ_CP053989.1 | Niallia circulans |
| 189 | 1645838 | 1646044 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 190 | 354297 | 354500 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 191 | 2369249 | 2369452 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 192 | 2607949 | 2608149 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 193 | 2356119 | 2356319 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 194 | 932024 | 932227 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 195 | 2555247 | 2555456 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 196 | 1164014 | 1164214 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 197 | 977008 | 977217 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 198 | 1571280 | 1571489 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 199 | 981801 | 982001 | + | NZ_CP026363.1 | Brevibacillus agri |
| 200 | 894955 | 895155 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 201 | 255508 | 255723 | - | NZ_CP022375.1 | Francisella opportunistica |
| 202 | 737516 | 737722 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 203 | 1411980 | 1412210 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 204 | 551102 | 551311 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 205 | 1121292 | 1121501 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 206 | 1792436 | 1792645 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 207 | 1776575 | 1776784 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 208 | 1164004 | 1164213 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 209 | 180423 | 180641 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 210 | 3924114 | 3924314 | - | NZ_LS483476.1 | Lederbergia lentus |
| 211 | 145385 | 145594 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 212 | 2296307 | 2296516 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 213 | 1757287 | 1757490 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 214 | 2471234 | 2471443 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 215 | 220665 | 220868 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 216 | 1833113 | 1833319 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 217 | 1218284 | 1218490 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 218 | 3802125 | 3802328 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 219 | 3402382 | 3402585 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 220 | 649777 | 649983 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 221 | 181513 | 181716 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 222 | 259582 | 259797 | - | NC_017449.1 | Francisella hispaniensis |
| 223 | 151583 | 151795 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 224 | 2829299 | 2829517 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 225 | 2989595 | 2989798 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 226 | 150313 | 150513 | - | NZ_HF545617.1 | Ruminococcus bicirculans |
| 227 | 2435482 | 2435679 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 228 | 817042 | 817239 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 229 | 250819 | 251043 | - | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 230 | 3514031 | 3514234 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 231 | 2451126 | 2451326 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 232 | 1165901 | 1166116 | + | NZ_CP012505.1 | Francisella persica ATCC VR-331 |
| 233 | 2877733 | 2877933 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 234 | 823712 | 823912 | - | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 235 | 1699374 | 1699583 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 236 | 1171075 | 1171272 | - | NZ_CP021434.1 | Tumebacillus avium |
| 237 | 2963247 | 2963456 | + | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 238 | 2491133 | 2491345 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 239 | 231876 | 232088 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 240 | 2509789 | 2509995 | + | NZ_HG917868.1 | Clostridium bornimense |
| 241 | 235872 | 236081 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 242 | 521484 | 521693 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 243 | 3515733 | 3515942 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 244 | 2213388 | 2213594 | - | NZ_CP023671.1 | Clostridium septicum |
| 245 | 5654031 | 5654249 | - | NZ_CP020953.1 | Clostridium drakei |
| 246 | 4247174 | 4247392 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 247 | 1444292 | 1444501 | - | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| 248 | 173412 | 173630 | - | NZ_CP028842.1 | Clostridium botulinum |
| 249 | 167296 | 167514 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 250 | 755627 | 755836 | - | NZ_CP027226.1 | Fastidiosipila sanguinis |
| 251 | 4807002 | 4807220 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 252 | 3278506 | 3278715 | + | NZ_CP030775.1 | Clostridium butyricum |
| 253 | 5723194 | 5723397 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 254 | 1528989 | 1529204 | + | NZ_CP038241.1 | Allofrancisella inopinata |
| 255 | 821710 | 821916 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 256 | 138969 | 139178 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 257 | 362910 | 363107 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 258 | 2166452 | 2166661 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 259 | 155684 | 155893 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 260 | 185611 | 185820 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 261 | 140102 | 140311 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 262 | 6433971 | 6434201 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 263 | 917345 | 917545 | + | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 264 | 2452203 | 2452409 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 265 | 2326381 | 2326584 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 266 | 1044840 | 1045055 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 267 | 2008319 | 2008555 | - | NZ_LR699119.1 | Aquicella siphonis |
| 268 | 412838 | 413053 | - | NZ_CP021781.1 | Francisella adeliensis |
| 269 | 457385 | 457621 | + | NZ_LR699114.1 | Aquicella lusitana |
| 270 | 9026116 | 9026328 | + | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 271 | 3996907 | 3997131 | - | NZ_CP016268.1 | Woeseia oceani |
| 272 | 2890235 | 2890447 | - | NZ_LS483250.1 | Moritella yayanosii |
| 273 | 1311431 | 1311646 | + | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 274 | 2488609 | 2488812 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 275 | 78240 | 78440 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 276 | 4560186 | 4560395 | + | NZ_CP014176.1 | Clostridium argentinense |
| 277 | 153681 | 153893 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 278 | 276649 | 276864 | - | NC_015696.1 | Francisella salina |
| 279 | 1520938 | 1521153 | + | NZ_CP043552.1 | Francisella marina |
| 280 | 3955895 | 3956125 | - | NZ_CP061800.1 | Desulfonema magnum |
| 281 | 545223 | 545444 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 282 | 317030 | 317233 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 283 | 680306 | 680521 | - | NZ_CP009654.1 | Francisella frigiditurris |
| 284 | 1914659 | 1914880 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 285 | 430547 | 430750 | + | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 286 | 3016151 | 3016366 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 287 | 3370789 | 3370992 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 288 | 271995 | 272204 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 289 | 1578851 | 1579075 | - | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 290 | 781775 | 781978 | - | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 291 | 460418 | 460627 | - | NZ_CP043998.1 | Clostridium diolis |
| 292 | 2306371 | 2306592 | - | NZ_CP059569.1 | Kingella oralis |
| 293 | 1942671 | 1942886 | + | NZ_CP016312.1 | Thermus brockianus |
| 294 | 1683175 | 1683384 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 295 | 1350715 | 1350930 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 296 | 2636871 | 2637089 | + | NC_006512.1 | Idiomarina loihiensis L2TR |
| 297 | 7078583 | 7078771 | + | NZ_CP030840.1 | Acidisarcina polymorpha |
| 298 | 296105 | 296320 | - | NZ_CP016796.1 | Francisella uliginis |
| 299 | 2269550 | 2269759 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 300 | 513802 | 514005 | - | NZ_CP014204.2 | Clostridium baratii |
| 301 | 2790616 | 2790831 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 302 | 1776103 | 1776321 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 303 | 2746538 | 2746750 | - | NZ_CP052766.1 | Alteromonas pelagimontana |
| 304 | 6421737 | 6421958 | - | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 305 | 2439269 | 2439472 | + | NZ_CP016786.1 | Clostridium isatidis |
| 306 | 3682654 | 3682866 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 307 | 6347894 | 6348115 | - | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 308 | 2041777 | 2042004 | + | NZ_CP012109.1 | Myxococcus hansupus |
| 309 | 773048 | 773263 | - | NZ_CP038452.1 | Thermus caldilimi |
| 310 | 3764087 | 3764296 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 311 | 589560 | 589793 | - | NZ_CP019633.1 | Sedimentisphaera cyanobacteriorum |
| 312 | 2741637 | 2741855 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 313 | 4109335 | 4109547 | + | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 314 | 1477900 | 1478124 | - | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 315 | 125908 | 126111 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 316 | 470514 | 470729 | - | NZ_CP022132.1 | Francisella halioticida |
| 317 | 2620074 | 2620304 | - | NZ_CP025491.2 | Legionella sainthelensi |
| 318 | 98468 | 98701 | - | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 319 | 354495 | 354716 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 320 | 2593002 | 2593205 | + | NZ_LR134374.1 | Legionella spiritensis |
| 321 | 122612 | 122815 | + | NZ_AP021881.1 | Sulfuriferula nivalis |
| 322 | 1012647 | 1012871 | - | NZ_CP019791.1 | Anaerohalosphaera lusitana |
| 323 | 2411565 | 2411777 | + | NZ_CP011451.1 | Nitrosomonas communis |
| 324 | 409568 | 409786 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 325 | 894659 | 894871 | + | NZ_CP054142.1 | Treponema parvum |
| 326 | 1699246 | 1699461 | - | NZ_CP022684.1 | Ketobacter alkanivorans |
| 327 | 672092 | 672307 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 328 | 3250106 | 3250306 | - | NZ_CP011971.1 | Steroidobacter denitrificans |
| 329 | 580771 | 581001 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 330 | 1083758 | 1083979 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 331 | 1519904 | 1520122 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 332 | 1795718 | 1795930 | - | NZ_LS483427.1 | Arcanobacterium haemolyticum |
| 333 | 2379376 | 2379603 | + | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 334 | 2791913 | 2792116 | + | NZ_AP014879.1 | Sulfuricaulis limicola |
| 335 | 2862129 | 2862353 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 336 | 2374470 | 2374694 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 337 | 2947317 | 2947541 | + | NZ_CP021106.3 | Nitrosospira lacus |
| 338 | 440953 | 441156 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 339 | 3851259 | 3851483 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 340 | 2621809 | 2622033 | - | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 341 | 94720 | 94923 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 342 | 517974 | 518186 | - | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 343 | 3113 | 3331 | - | NC_020127.1 | Lawsonia intracellularis N343 |
| 344 | 214010 | 214213 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 345 | 1521412 | 1521636 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 346 | 4646677 | 4646901 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 347 | 3538039 | 3538251 | - | NC_008709.1 | Psychromonas ingrahamii 37 |
| 348 | 729242 | 729469 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 349 | 538550 | 538762 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 350 | 769808 | 770020 | + | NZ_AP012331.1 | Bifidobacterium scardovii JCM 12489 = DSM 13734 |
| 351 | 997696 | 997926 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 352 | 4133703 | 4133921 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 353 | 341339 | 341539 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 354 | 256391 | 256612 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 355 | 68523 | 68744 | - | NZ_CP033719.1 | Propionibacterium acidifaciens |
| 356 | 1821139 | 1821342 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 357 | 1825806 | 1826012 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 358 | 2086914 | 2087144 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 359 | 585580 | 585789 | - | NC_004545.1 | Buchnera aphidicola str. Bp (Baizongia pistaciae) |
| 360 | 2323789 | 2324013 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 361 | 3542673 | 3542876 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 362 | 1670762 | 1670965 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 363 | 1487154 | 1487381 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 364 | 507236 | 507457 | + | NZ_CP066065.1 | Schaalia meyeri |
| 365 | 191470 | 191694 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 366 | 544401 | 544604 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 367 | 366226 | 366435 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 368 | 246825 | 247034 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 369 | 1281592 | 1281825 | - | NZ_LS483468.1 | Rhodococcus coprophilus |
| 370 | 3939946 | 3940146 | + | NC_018020.1 | Turneriella parva DSM 21527 |
| 371 | 7327461 | 7327685 | - | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 372 | 7818507 | 7818731 | - | NC_017093.1 | Actinoplanes missouriensis 431 |
| 373 | 1485727 | 1485942 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 374 | 3546069 | 3546284 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 375 | 3082368 | 3082580 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 376 | 764942 | 765145 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 377 | 511833 | 512048 | - | NC_016893.1 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans morsitans (Yale colony) |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007503.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00472.22 | 0.6 | 226 | 1267.0 | same-strand | RF-1 domain |
++ More..