Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00418 |
NCBI Accession ID | NC_016810.1 |
Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
Left | 3418253 |
Right | 3418390 |
Strand | - |
Nucleotide Sequence | ATGGCCATTACGCTGCTACCGACCAGCGCCCAGGAGCGCAGGCTTAACACCGTATTCCAGCCGCGATCGTACGCGCCGGTGGTCTCCAGCCAGTCGCGACGGCTGGCGGACAGATCCAGCCGTTGCTGCTGGATCTGA |
Sequence | MAITLLPTSAQERRLNTVFQPRSYAPVVSSQSRRLADRSSRCCWI |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | Venturini et al 2020 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 45 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3397555 | 3397692 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 4258206 | 4258364 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
3 | 4032324 | 4032452 | + | NZ_CP038469.1 | Citrobacter tructae |
4 | 3646172 | 3646318 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13721.8 | 1.0 | 4 | 1302.5 | opposite-strand | SecD export protein N-terminal TM region |
2 | PF06476.14 | 1.0 | 4 | 785.0 | opposite-strand | Protein of unknown function (DUF1090) |
3 | PF19029.2 | 1.0 | 4 | 445.0 | opposite-strand | DUF883 C-terminal glycine zipper region |
4 | PF05957.15 | 1.0 | 4 | 445.0 | opposite-strand | DUF883 N-terminal domain |
5 | PF07332.13 | 1.0 | 4 | 45.5 | opposite-strand | Putative Actinobacterial Holin-X, holin superfamily III |
6 | PF13997.8 | 1.0 | 4 | -141.5 | opposite-strand | YqjK-like protein |
7 | PF07681.14 | 1.0 | 4 | 325.0 | opposite-strand | DoxX |
8 | PF13409.8 | 1.0 | 4 | 807.0 | opposite-strand | Glutathione S-transferase, N-terminal domain |
9 | PF13410.8 | 0.75 | 3 | 801 | opposite-strand | Glutathione S-transferase, C-terminal domain |
10 | PF05656.16 | 1.0 | 4 | 1923.0 | opposite-strand | Protein of unknown function (DUF805) |
11 | PF03466.22 | 0.75 | 3 | 2345 | same-strand | LysR substrate binding domain |
12 | PF00126.29 | 0.75 | 3 | 2345 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |