Result : EXP00418
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00418 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 3418253 |
| Right | 3418390 |
| Strand | - |
| Nucleotide Sequence | ATGGCCATTACGCTGCTACCGACCAGCGCCCAGGAGCGCAGGCTTAACACCGTATTCCAGCCGCGATCGTACGCGCCGGTGGTCTCCAGCCAGTCGCGACGGCTGGCGGACAGATCCAGCCGTTGCTGCTGGATCTGA |
| Sequence | MAITLLPTSAQERRLNTVFQPRSYAPVVSSQSRRLADRSSRCCWI |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3397555 | 3397692 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 4258206 | 4258364 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 3 | 4032324 | 4032452 | + | NZ_CP038469.1 | Citrobacter tructae |
| 4 | 3646172 | 3646318 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13721.8 | 1.0 | 4 | 1302.5 | opposite-strand | SecD export protein N-terminal TM region |
| 2 | PF06476.14 | 1.0 | 4 | 785.0 | opposite-strand | Protein of unknown function (DUF1090) |
| 3 | PF19029.2 | 1.0 | 4 | 445.0 | opposite-strand | DUF883 C-terminal glycine zipper region |
| 4 | PF05957.15 | 1.0 | 4 | 445.0 | opposite-strand | DUF883 N-terminal domain |
| 5 | PF07332.13 | 1.0 | 4 | 45.5 | opposite-strand | Putative Actinobacterial Holin-X, holin superfamily III |
| 6 | PF13997.8 | 1.0 | 4 | -141.5 | opposite-strand | YqjK-like protein |
| 7 | PF07681.14 | 1.0 | 4 | 325.0 | opposite-strand | DoxX |
| 8 | PF13409.8 | 1.0 | 4 | 807.0 | opposite-strand | Glutathione S-transferase, N-terminal domain |
| 9 | PF13410.8 | 0.75 | 3 | 801 | opposite-strand | Glutathione S-transferase, C-terminal domain |
| 10 | PF05656.16 | 1.0 | 4 | 1923.0 | opposite-strand | Protein of unknown function (DUF805) |
| 11 | PF03466.22 | 0.75 | 3 | 2345 | same-strand | LysR substrate binding domain |
| 12 | PF00126.29 | 0.75 | 3 | 2345 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
++ More..