Result : EXP00417
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00417 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 3379357 |
| Right | 3379596 |
| Strand | - |
| Nucleotide Sequence | GTGGACGCCATAAACCAGAATTGTGTGACGTCATACGGAGTAAAGGCGTTGATGAAGGTAATCAATAGCGTTATAGTTAACCCGCTTATTCTCAGGGCGGGGCGAAATTCCCCACCGGCGGTAAATCAGCGATGTTTAACGCATTTCTCATCACGGCGCGCCGTGACGGAACGCGGAGAGCAGGTTGAAAGCCCGCGAGCGCTTTTTGCCATAGCGAAAAGGTCAGCAGATCCGGTGTAA |
| Sequence | VDAINQNCVTSYGVKALMKVINSVIVNPLILRAGRNSPPAVNQRCLTHFSSRRAVTERGEQVESPRALFAIAKRSADPV |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3358659 | 3358898 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 3782742 | 3782960 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17425.4 | 1.0 | 2 | 2727.0 | opposite-strand | Arylsulfotransferase Ig-like domain |
| 2 | PF01323.22 | 1.0 | 2 | 1618.5 | opposite-strand | DSBA-like thioredoxin domain |
| 3 | PF13462.8 | 1.0 | 2 | 1618.5 | opposite-strand | Thioredoxin |
| 4 | PF02600.18 | 1.0 | 2 | 926.5 | opposite-strand | Disulfide bond formation protein DsbB |
| 5 | PF00926.21 | 1.0 | 2 | 138.5 | same-strand | 3,4-dihydroxy-2-butanone 4-phosphate synthase |
| 6 | PF04380.15 | 1.0 | 2 | 45.5 | opposite-strand | Membrane fusogenic activity |
| 7 | PF08971.13 | 1.0 | 2 | 400.0 | same-strand | Glycogen synthesis protein |
| 8 | PF07290.13 | 1.0 | 2 | 868.0 | opposite-strand | Protein of unknown function (DUF1449) |
| 9 | PF15975.7 | 1.0 | 2 | 1514.0 | opposite-strand | Flotillin |
| 10 | PF00294.26 | 1.0 | 2 | 3448.0 | same-strand | pfkB family carbohydrate kinase |
| 11 | PF01467.28 | 1.0 | 2 | 3448.0 | same-strand | Cytidylyltransferase-like |
++ More..