Result : EXP00409
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00409 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 4597979 |
| Right | 4598083 |
| Strand | + |
| Nucleotide Sequence | ATGGTTAGCGTTTTTCCTGCGATGATGCCATGCGTAGATTATGCAACGCGCGCATGCATTGATCTTGCGTCAGACGCGCTGCTTTACCGGTTCCAAGCGTTCTGA |
| Sequence | MVSVFPAMMPCVDYATRACIDLASDALLYRFQAF |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4577414 | 4577518 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 2357547 | 2357651 | + | NZ_CP053416.1 | Salmonella bongori |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04186.15 | 1.0 | 2 | 4202.5 | same-strand | FxsA cytoplasmic membrane protein |
| 2 | PF13520.8 | 1.0 | 2 | 2901.5 | opposite-strand | Amino acid permease |
| 3 | PF00324.23 | 1.0 | 2 | 2901.5 | opposite-strand | Amino acid permease |
| 4 | PF00166.23 | 1.0 | 2 | 2343.0 | same-strand | Chaperonin 10 Kd subunit |
| 5 | PF00118.26 | 1.0 | 2 | 653.0 | same-strand | TCP-1/cpn60 chaperonin family |
| 6 | PF13698.8 | 1.0 | 2 | 44.0 | same-strand | Domain of unknown function (DUF4156) |
| 7 | PF15922.7 | 1.0 | 2 | -100.0 | opposite-strand | YjeJ-like |
| 8 | PF04055.23 | 1.0 | 2 | 1040.0 | opposite-strand | Radical SAM superfamily |
| 9 | PF09285.13 | 1.0 | 2 | 2109.0 | same-strand | Elongation factor P, C-terminal |
| 10 | PF08207.14 | 1.0 | 2 | 2109.0 | same-strand | Elongation factor P (EF-P) KOW-like domain |
| 11 | PF01132.22 | 1.0 | 2 | 2109.0 | same-strand | Elongation factor P (EF-P) OB domain |
| 12 | PF08085.13 | 1.0 | 2 | 2832.5 | same-strand | Entericidin EcnA/B family |
| 13 | PF00196.21 | 1.0 | 2 | 3149.5 | opposite-strand | Bacterial regulatory proteins, luxR family |
| 14 | PF08281.14 | 1.0 | 2 | 3149.5 | opposite-strand | Sigma-70, region 4 |
++ More..