Result : B1I6E6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP000860.1 |
| Organism | Desulforudis audaxviator (strain MP104C) |
| Left | 2178915 |
| Right | 2179181 |
| Strand | + |
| Nucleotide Sequence | GTGGCACACAGCCGTTCAGCCAAGAAACGGATTGAGACCATCCGCAAGCGCACCGAGCGGAACAAGAGCGCTAAGTCCGCGCTCAAAACGGCGATCAGGCGATTTGAAGAAGCGGTGCAAGGGGATGATAAGGAACAGGCCCGCGAGAAGCTGCAGAAGGCGCTTGTATCTATCGATAAAGGGGTTTCCAAAGGCATCCTGCACAAGAATACCGCTGCGCGCCGGAAGTCGCGCCTGACCAAGAAATTTAACATCATTACCGGCTAA |
| Sequence | MAHSRSAKKRIETIRKRTERNKSAKSALKTAIRRFEEAVQGDDKEQAREKLQKALVSIDKGVSKGILHKNTAARRKSRLTKKFNIITG |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1I6E6 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 100
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1342827 | 1343096 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 2 | 2658258 | 2658521 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 3 | 2726250 | 2726516 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 4 | 348241 | 348513 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 5 | 1161188 | 1161454 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 6 | 1246787 | 1247053 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 7 | 3457402 | 3457668 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 8 | 945760 | 946041 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 9 | 2053248 | 2053535 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 10 | 2939750 | 2940016 | - | NZ_CP021434.1 | Tumebacillus avium |
| 11 | 3418501 | 3418767 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 12 | 775890 | 776153 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 13 | 2744211 | 2744474 | + | NZ_CP030280.1 | Blautia argi |
| 14 | 1586759 | 1587031 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 15 | 955400 | 955681 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 16 | 938107 | 938388 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 17 | 1063696 | 1063980 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 18 | 1441334 | 1441600 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 19 | 1981373 | 1981636 | + | NZ_CP014204.2 | Clostridium baratii |
| 20 | 2418421 | 2418687 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 21 | 1224761 | 1225051 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 22 | 2491396 | 2491662 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 23 | 1567815 | 1568033 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 24 | 1560839 | 1561102 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 25 | 1640163 | 1640423 | - | NZ_CP039126.1 | Blautia producta |
| 26 | 1437357 | 1437641 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 27 | 2548089 | 2548352 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 28 | 2078795 | 2079058 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 29 | 3827086 | 3827352 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 30 | 1973964 | 1974254 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 31 | 3359032 | 3359298 | + | NZ_CP011663.1 | Clostridium sporogenes |
| 32 | 1111331 | 1111594 | - | NZ_LN879430.1 | Herbinix luporum |
| 33 | 983759 | 984022 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 34 | 2545967 | 2546233 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 35 | 528895 | 529125 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 36 | 1734268 | 1734528 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 37 | 2335015 | 2335281 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 38 | 1778048 | 1778305 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 39 | 1724428 | 1724700 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 40 | 2149612 | 2149878 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 41 | 4575886 | 4576158 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 42 | 2298586 | 2298846 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 43 | 2828653 | 2828913 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 44 | 1733744 | 1734013 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 45 | 110877 | 111137 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 46 | 3070049 | 3070285 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 47 | 3692896 | 3693168 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 48 | 1723165 | 1723431 | + | NC_008593.1 | Clostridium novyi NT |
| 49 | 1974129 | 1974395 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 50 | 3454838 | 3455107 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 51 | 716907 | 717167 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 52 | 4203825 | 4204046 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 53 | 1641457 | 1641717 | + | NZ_HG917868.1 | Clostridium bornimense |
| 54 | 955818 | 956084 | + | NZ_CP044427.1 | Ornithinimicrobium pratense |
| 55 | 1074693 | 1074959 | + | NZ_CP038213.1 | Ornithinimicrobium flavum |
| 56 | 2486200 | 2486472 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 57 | 1651 | 1905 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 58 | 2247195 | 2247458 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 59 | 2588742 | 2589002 | + | NZ_CP066049.1 | Actinomyces naeslundii |
| 60 | 2049325 | 2049597 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 61 | 173386 | 173646 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 62 | 1546791 | 1547051 | + | NZ_CP066060.1 | Actinomyces oris |
| 63 | 3520724 | 3520984 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 64 | 996213 | 996473 | - | NZ_CP053642.1 | Actinomyces marmotae |
| 65 | 1343447 | 1343707 | + | NZ_CP020468.1 | Actinomyces gaoshouyii |
| 66 | 1338521 | 1338796 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 67 | 1192876 | 1193136 | + | NZ_LR134357.1 | Actinomyces israelii |
| 68 | 1513327 | 1513587 | + | NZ_CP035504.1 | Kocuria indica |
| 69 | 1519501 | 1519761 | + | NZ_CP066802.1 | Actinomyces weissii |
| 70 | 5222085 | 5222327 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 71 | 3354094 | 3354360 | + | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 72 | 520231 | 520491 | - | NZ_LR134477.1 | Actinomyces viscosus |
| 73 | 1516489 | 1516749 | - | NZ_CP035037.1 | Leucobacter muris |
| 74 | 1667289 | 1667549 | + | NZ_CP034412.1 | Glutamicibacter creatinolyticus |
| 75 | 1991014 | 1991274 | - | NC_012669.1 | Beutenbergia cavernae DSM 12333 |
| 76 | 96717 | 96977 | + | NZ_CP032630.1 | Protaetiibacter intestinalis |
| 77 | 1937645 | 1937905 | - | NZ_LR134363.1 | Actinomyces slackii |
| 78 | 195153 | 195413 | - | NZ_LR134350.1 | Actinomyces howellii |
| 79 | 1347663 | 1347923 | - | NC_015671.1 | Cellulomonas gilvus ATCC 13127 |
| 80 | 1552283 | 1552558 | + | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 81 | 1418135 | 1418395 | - | NZ_CP039291.1 | Cellulomonas shaoxiangyii |
| 82 | 4185416 | 4185652 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 83 | 1603424 | 1603684 | - | NZ_CP071883.1 | Curtobacterium flaccumfaciens pv. flaccumfaciens |
| 84 | 1573111 | 1573371 | + | NZ_LR131272.1 | Arthrobacter agilis |
| 85 | 2474957 | 2475217 | + | NZ_CP013254.1 | Kocuria flava |
| 86 | 644463 | 644729 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 87 | 1601217 | 1601477 | + | NZ_CP044344.1 | Nocardioides cynanchi |
| 88 | 1093862 | 1094128 | - | NZ_LS483427.1 | Arcanobacterium haemolyticum |
| 89 | 2000088 | 2000360 | + | NZ_AP022871.1 | Phytohabitans suffuscus |
| 90 | 2432230 | 2432484 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 91 | 2481518 | 2481778 | + | NC_014151.1 | Cellulomonas flavigena DSM 20109 |
| 92 | 1221066 | 1221329 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 93 | 1330132 | 1330401 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 94 | 75769 | 76038 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 95 | 2838508 | 2838768 | + | NZ_CP014228.1 | Actinomyces radicidentis |
| 96 | 795859 | 796119 | + | NZ_CP040508.1 | Rhodoluna limnophila |
| 97 | 622689 | 622949 | - | NZ_CP007490.1 | Rhodoluna lacicola |
| 98 | 1667005 | 1667265 | - | NZ_CP031422.1 | Microbacterium oxydans |
| 99 | 3551600 | 3551860 | + | NZ_CP032624.1 | Gryllotalpicola protaetiae |
| 100 | 2639112 | 2639372 | + | NZ_CP029642.1 | Arthrobacter dokdonellae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019698.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06144.15 | 0.73 | 73 | 96 | opposite-strand | DNA polymerase III, delta subunit |
| 2 | PF03772.18 | 0.65 | 65 | 1385 | opposite-strand | Competence protein |
++ More..