ProsmORF-pred
Result : EXP00407
Protein Information
Information Type Description
Protein name EXP00407
NCBI Accession ID NC_016810.1
Organism Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Left 2969532
Right 2969711
Strand +
Nucleotide Sequence ATGTTCACACCAGGCGATATCGTACAGCCCCGAATGGGTGGGCCGAAACTGAAAGTGATTGAAGTCAACGAGGATCATATTGTCGCGGTACAGGTCGGTAATGAACCGGGCGAAAAATTGATCCTCAAAGCGGCAGATGTCACCCCCTATTGCGAAGAGGGCGATTTTGGCGTGTGCTGA
Sequence MFTPGDIVQPRMGGPKLKVIEVNEDHIVAVQVGNEPGEKLILKAADVTPYCEEGDFGVC
Source of smORF Ribo-seq
Function
Pubmed ID Venturini et al 2020
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 59
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 46
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2946960 2947139 + NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
2 771670 771849 + NZ_CP053416.1 Salmonella bongori
3 3550225 3550404 - NZ_CP044098.1 Citrobacter portucalensis
4 1590406 1590585 + NZ_CP033744.1 Citrobacter freundii
5 1204564 1204743 - NZ_CP050508.1 Raoultella terrigena
6 534825 535004 + NZ_CP026047.1 Raoultella planticola
7 1074592 1074771 - NZ_CP041247.1 Raoultella electrica
8 1158021 1158200 - NZ_CP046672.1 Raoultella ornithinolytica
9 3636410 3636589 + NC_015968.1 Enterobacter soli
10 1119766 1119945 - NZ_LR134475.1 Klebsiella aerogenes
11 1274802 1274981 - NZ_CP060111.1 Klebsiella michiganensis
12 1385290 1385469 + NZ_AP019007.1 Enterobacter oligotrophicus
13 3937845 3938024 + NZ_CP043318.1 Enterobacter chengduensis
14 1075880 1076059 - NZ_CP013990.1 Leclercia adecarboxylata
15 3629287 3629466 - NZ_CP025034.2 Enterobacter sp. SGAir0187
16 1379822 1380001 - NZ_CP036175.1 Klebsiella huaxiensis
17 3732424 3732603 + NZ_CP009756.1 Enterobacter cloacae
18 4739478 4739657 - NZ_CP017279.1 Enterobacter ludwigii
19 2353601 2353780 + NZ_CP023529.1 Lelliottia amnigena
20 3596640 3596819 + NZ_AP022508.1 Enterobacter bugandensis
21 3648761 3648940 + NZ_CP017184.1 Enterobacter roggenkampii
22 1099116 1099295 - NZ_CP045845.1 Kluyvera intermedia
23 4215182 4215361 - NZ_CP045300.1 Kosakonia arachidis
24 5139072 5139251 + NZ_CP040428.1 Jejubacter calystegiae
25 3999811 3999990 + NZ_CP015113.1 Kosakonia radicincitans
26 3373782 3373961 + NZ_CP012264.1 Cronobacter condimenti 1330
27 1678145 1678324 - NZ_CP051548.1 Phytobacter diazotrophicus
28 1182535 1182714 - NZ_CP014007.2 Kosakonia oryzae
29 349166 349345 - NZ_CP011602.1 Phytobacter ursingii
30 3640753 3640932 + NZ_CP027986.1 Enterobacter sichuanensis
31 3289417 3289596 + NZ_CP012257.1 Cronobacter universalis NCTC 9529
32 797700 797879 - NZ_CP013940.1 Cronobacter malonaticus LMG 23826
33 3498044 3498223 + NZ_CP012266.1 Cronobacter dublinensis subsp. dublinensis LMG 23823
34 636904 637083 - NZ_CP012268.1 Cronobacter muytjensii ATCC 51329
35 1036737 1036916 - NZ_CP035129.1 Kosakonia cowanii
36 954879 955058 - NZ_CP054058.1 Scandinavium goeteborgense
37 4747664 4747843 - NZ_CP045769.1 Enterobacter cancerogenus
38 3775274 3775453 + NZ_CP063425.1 Kosakonia pseudosacchari
39 4245550 4245729 - NZ_CP016337.1 Kosakonia sacchari
40 76695 76874 - NZ_CP027107.1 Cronobacter sakazakii
41 4105217 4105396 + NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
42 1145578 1145757 - NZ_CP054254.1 Klebsiella variicola
43 1142691 1142870 - NZ_CP065838.1 Klebsiella quasipneumoniae
44 5086371 5086550 + NZ_CP020388.1 Pluralibacter gergoviae
45 822112 822291 - NZ_LR134201.1 Cedecea lapagei
46 823919 824098 - NZ_CP023525.1 Cedecea neteri
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_003197.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01679.19 0.7 32 228.5 opposite-strand Proteolipid membrane potential modulator
2 PF00581.22 0.63 29 91 same-strand Rhodanese-like domain
3 PF00816.23 0.61 28 40.5 opposite-strand H-NS histone family
4 PF06610.15 0.98 45 937 same-strand L-alanine exporter
5 PF09400.12 1.0 46 1419.0 opposite-strand Protein of unknown function (DUF2002)
6 PF19029.2 0.93 43 1924 same-strand DUF883 C-terminal glycine zipper region
7 PF05957.15 0.93 43 1924 same-strand DUF883 N-terminal domain
++ More..