Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00405 |
NCBI Accession ID | NC_016810.1 |
Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
Left | 1314466 |
Right | 1314573 |
Strand | + |
Nucleotide Sequence | ATGTACGATCCACCGTTTCTTGAAGCGCTGATGATTACGGCGTCGTTTTTCGCCATTTTTATCATTATCGTTGTGTCGGTATTGCTCCTTGAAGGGGGAGGGGACTAA |
Sequence | MYDPPFLEALMITASFFAIFIIIVVSVLLLEGGGD |
Source of smORF | Ribo-seq |
Function | integral component of membrane [GO:0016021] |
Pubmed ID | Venturini et al 2020 |
Domain | |
Functional Category | Gene Ontology/Expression based functional assignment |
Uniprot ID | Q8ZPW6 |
ORF Length (Amino Acid) | 35 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1357604 | 1357711 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 3762531 | 3762635 | + | NZ_CP053416.1 | Salmonella bongori |
3 | 1071823 | 1071927 | + | NZ_CP017279.1 | Enterobacter ludwigii |
4 | 1869287 | 1869391 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
5 | 4323461 | 4323565 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
6 | 3509766 | 3509870 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
7 | 3502787 | 3502891 | - | NZ_CP045205.1 | Citrobacter telavivensis |
8 | 2085635 | 2085739 | + | NZ_CP043318.1 | Enterobacter chengduensis |
9 | 856051 | 856155 | - | NZ_CP057657.1 | Escherichia fergusonii |
10 | 1804491 | 1804595 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
11 | 689879 | 689983 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
12 | 1835109 | 1835213 | + | NZ_AP022508.1 | Enterobacter bugandensis |
13 | 1827234 | 1827338 | + | NC_015968.1 | Enterobacter soli |
14 | 724728 | 724832 | + | NZ_CP023529.1 | Lelliottia amnigena |
15 | 1721860 | 1721964 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
16 | 1361838 | 1361942 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
17 | 1852707 | 1852811 | + | NZ_CP009756.1 | Enterobacter cloacae |
18 | 1639819 | 1639923 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
19 | 1809140 | 1809244 | - | NZ_AP014857.1 | Escherichia albertii |
20 | 2700311 | 2700415 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
21 | 1874078 | 1874182 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
22 | 2060275 | 2060379 | + | NZ_CP061527.1 | Shigella dysenteriae |
23 | 2475820 | 2475924 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04343.15 | 0.77 | 17 | 3488.0 | opposite-strand | Protein of unknown function, DUF488 |
2 | PF07690.18 | 0.91 | 20 | 1491 | opposite-strand | Major Facilitator Superfamily |
3 | PF12833.9 | 0.86 | 19 | 577.5 | same-strand | Helix-turn-helix domain |
4 | PF04284.15 | 1.0 | 22 | 170 | opposite-strand | Protein of unknown function (DUF441) |
5 | PF04073.17 | 1.0 | 22 | 6 | opposite-strand | Aminoacyl-tRNA editing domain |
6 | PF04285.14 | 0.91 | 20 | 2164 | opposite-strand | Protein of unknown function (DUF444) |
7 | PF08298.13 | 0.91 | 20 | 3571 | opposite-strand | PrkA AAA domain |
8 | PF06798.14 | 0.91 | 20 | 3571 | opposite-strand | PrkA serine protein kinase C-terminal domain |
9 | PF06629.14 | 0.64 | 14 | 4861.5 | same-strand | MltA-interacting protein MipA |