Result : EXP00392
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00392 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 2903734 |
| Right | 2903886 |
| Strand | - |
| Nucleotide Sequence | ATGATTGAGCAACGCATCCTCCCTCGTGAAACGGGGGAGGGGGACCGCGAAGCGGTGGAGGGAGCGCAGCCACTGGGGACGCCCCCTCCGTCACGCCGCGTCTTCGCGGCGCGCCACCTCCCCCGCCTTGCGGGTGAGGAGGGAGGCCGGTGA |
| Sequence | MIEQRILPRETGEGDREAVEGAQPLGTPPPSRRVFAARHLPRLAGEEGGR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2903734 | 2903886 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 304445 | 304603 | - | NZ_CP026100.1 | Caulobacter flavus |
| 3 | 3881878 | 3882003 | - | NZ_CP027850.1 | Caulobacter segnis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00593.26 | 0.67 | 2 | 1950 | opposite-strand | TonB dependent receptor |
| 2 | PF07715.17 | 0.67 | 2 | 1950 | opposite-strand | TonB-dependent Receptor Plug Domain |
| 3 | PF00440.25 | 0.67 | 2 | 1893.5 | both-strands | Bacterial regulatory proteins, tetR family |
++ More..