Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00392 |
NCBI Accession ID | NC_011916.1 |
Organism | Caulobacter vibrioides NA1000 |
Left | 2903734 |
Right | 2903886 |
Strand | - |
Nucleotide Sequence | ATGATTGAGCAACGCATCCTCCCTCGTGAAACGGGGGAGGGGGACCGCGAAGCGGTGGAGGGAGCGCAGCCACTGGGGACGCCCCCTCCGTCACGCCGCGTCTTCGCGGCGCGCCACCTCCCCCGCCTTGCGGGTGAGGAGGGAGGCCGGTGA |
Sequence | MIEQRILPRETGEGDREAVEGAQPLGTPPPSRRVFAARHLPRLAGEEGGR |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 25078267 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 50 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2903734 | 2903886 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
2 | 304445 | 304603 | - | NZ_CP026100.1 | Caulobacter flavus |
3 | 3881878 | 3882003 | - | NZ_CP027850.1 | Caulobacter segnis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00593.26 | 0.67 | 2 | 1950 | opposite-strand | TonB dependent receptor |
2 | PF07715.17 | 0.67 | 2 | 1950 | opposite-strand | TonB-dependent Receptor Plug Domain |
3 | PF00440.25 | 0.67 | 2 | 1893.5 | both-strands | Bacterial regulatory proteins, tetR family |