Result : EXP00391
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00391 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 2824196 |
| Right | 2824309 |
| Strand | - |
| Nucleotide Sequence | ATGGAGGCTCCCATGATCAGCAAGACGGAAGACCGCTTCGTCCTTCCCGTTTCCCTGACCGTGGGGCTGCATGTCCTTCATCACCCTGGATTCTGTCGCCGCCGCCACGCCTGA |
| Sequence | MEAPMISKTEDRFVLPVSLTVGLHVLHHPGFCRRRHA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2824196 | 2824309 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 1192361 | 1192474 | + | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 969092 | 969196 | + | NZ_CP013002.1 | Caulobacter henricii |
| 4 | 1792599 | 1792721 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 5 | 1276489 | 1276605 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048815.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10135.11 | 0.6 | 3 | 3988 | opposite-strand | Rod binding protein |
| 2 | PF00005.29 | 1.0 | 5 | -46 | same-strand | ABC transporter |
| 3 | PF17760.3 | 0.8 | 4 | 1382.0 | opposite-strand | UvrA interaction domain |
| 4 | PF17755.3 | 0.8 | 4 | 1382.0 | opposite-strand | UvrA DNA-binding domain |
| 5 | PF06718.13 | 0.6 | 3 | 835 | opposite-strand | Protein of unknown function (DUF1203) |
++ More..