Result : B1I193
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative septation protein SpoVG |
| NCBI Accession ID | CP000860.1 |
| Organism | Desulforudis audaxviator (strain MP104C) |
| Left | 69859 |
| Right | 70125 |
| Strand | + |
| Nucleotide Sequence | GTGGAGGTCACTGACGTCCGGATACGTAAAGTTTTGGACGGGGGTAAAATGAAGGCGATTGTGTCGGTCACCCTGGACGACGCTTTCGTGGTGCACGACATCAAAATCGTCGAGGGCCAGAACGGGTTGTTTGTCGCAATGCCCAGCCGCAGGACCCCCAACGGAGAGTTCCGTGACATCGCCCACCCAATTAACGCCTCCGCGCGCGCCCGGATCCAGAATGCAGTGCTGGAAGCCTATGAGCACCGGGATGCCGCGGAATTCTAA |
| Sequence | MEVTDVRIRKVLDGGKMKAIVSVTLDDAFVVHDIKIVEGQNGLFVAMPSRRTPNGEFRDIAHPINASARARIQNAVLEAYEHRDAAEF |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in septation. {ECO:0000255|HAMAP-Rule:MF_00819}. |
| Pubmed ID | |
| Domain | CDD:412646 |
| Functional Category | Others |
| Uniprot ID | B1I193 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 295
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 104513 | 104767 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 2 | 244248 | 244502 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 3 | 162721 | 162975 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 4 | 222587 | 222841 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 5 | 158631 | 158912 | + | NZ_CP016786.1 | Clostridium isatidis |
| 6 | 102024 | 102278 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 7 | 63412 | 63675 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 8 | 189753 | 190028 | + | NZ_CP014204.2 | Clostridium baratii |
| 9 | 2350963 | 2351253 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 10 | 343775 | 344062 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 11 | 2209600 | 2209878 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 12 | 3450794 | 3451084 | - | NZ_CP040924.1 | Clostridium thermarum |
| 13 | 97634 | 97945 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 14 | 112221 | 112496 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 15 | 3625658 | 3625933 | - | NZ_CP030775.1 | Clostridium butyricum |
| 16 | 3374577 | 3374864 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 17 | 126929 | 127204 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 18 | 602074 | 602325 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 19 | 2474553 | 2474834 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 20 | 153718 | 153999 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 21 | 1936260 | 1936523 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 22 | 2752391 | 2752678 | - | NZ_HG917868.1 | Clostridium bornimense |
| 23 | 1043863 | 1044135 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 24 | 188287 | 188568 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 25 | 102620 | 102895 | + | NZ_CP043998.1 | Clostridium diolis |
| 26 | 2273415 | 2273681 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 27 | 2332127 | 2332393 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 28 | 174146 | 174424 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 29 | 2617192 | 2617470 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 30 | 2724860 | 2725150 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 31 | 4591589 | 4591867 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 32 | 2154012 | 2154302 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 33 | 4521242 | 4521532 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 34 | 236915 | 237199 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 35 | 540453 | 540740 | + | NZ_CP014176.1 | Clostridium argentinense |
| 36 | 361870 | 362136 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 37 | 2632500 | 2632766 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 38 | 2130324 | 2130590 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 39 | 2689403 | 2689669 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 40 | 2550878 | 2551144 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 41 | 2962234 | 2962521 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 42 | 55984 | 56268 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 43 | 2035820 | 2036083 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 44 | 353983 | 354249 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 45 | 367156 | 367422 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 46 | 2463420 | 2463695 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 47 | 4013428 | 4013715 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 48 | 76078 | 76362 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 49 | 3630706 | 3630957 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 50 | 50428 | 50712 | + | NZ_CP016540.2 | Planococcus versutus |
| 51 | 99455 | 99712 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 52 | 3763771 | 3764058 | - | NZ_CP028842.1 | Clostridium botulinum |
| 53 | 4044792 | 4045079 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 54 | 84878 | 85132 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 55 | 92900 | 93154 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 56 | 5372717 | 5373007 | - | NZ_CP020953.1 | Clostridium drakei |
| 57 | 4516057 | 4516347 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 58 | 4551455 | 4551745 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 59 | 135810 | 136100 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 60 | 2837767 | 2838021 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 61 | 1067796 | 1068068 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 62 | 1705838 | 1706122 | - | NZ_CP013661.2 | Planococcus kocurii |
| 63 | 56748 | 57032 | + | NZ_CP019401.1 | Planococcus faecalis |
| 64 | 55309 | 55563 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 65 | 1919751 | 1919987 | + | NZ_CP023671.1 | Clostridium septicum |
| 66 | 155185 | 155421 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 67 | 64299 | 64598 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 68 | 3075372 | 3075644 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 69 | 2170009 | 2170287 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 70 | 2287459 | 2287737 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 71 | 148197 | 148472 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 72 | 54842 | 55096 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 73 | 52066 | 52320 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 74 | 55723 | 55977 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 75 | 2320861 | 2321166 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 76 | 1620281 | 1620589 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 77 | 278724 | 279032 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 78 | 221776 | 222033 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 79 | 1262152 | 1262421 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 80 | 64508 | 64807 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 81 | 57347 | 57631 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 82 | 53030 | 53320 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 83 | 3743535 | 3743801 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 84 | 56523 | 56777 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 85 | 485546 | 485848 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 86 | 2873723 | 2874004 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 87 | 1458971 | 1459261 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 88 | 2646225 | 2646518 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 89 | 1142964 | 1143254 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 90 | 2289204 | 2289512 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 91 | 2329650 | 2329958 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 92 | 179988 | 180290 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 93 | 468929 | 469231 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 94 | 67403 | 67693 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 95 | 480650 | 480952 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 96 | 4630038 | 4630322 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 97 | 2891609 | 2891893 | - | NZ_CP030280.1 | Blautia argi |
| 98 | 53066 | 53356 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 99 | 56683 | 56976 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 100 | 3523847 | 3524146 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 101 | 2622463 | 2622753 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 102 | 54365 | 54649 | + | NZ_CP016538.2 | Planococcus maritimus |
| 103 | 54253 | 54537 | + | NZ_CP059540.1 | Planococcus maritimus |
| 104 | 135982 | 136281 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 105 | 252515 | 252805 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 106 | 203850 | 204107 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 107 | 2496224 | 2496520 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 108 | 2517239 | 2517535 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 109 | 1065736 | 1066044 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 110 | 1270577 | 1270882 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 111 | 2776104 | 2776400 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 112 | 2165812 | 2166108 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 113 | 1683218 | 1683514 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 114 | 1448140 | 1448427 | - | NZ_CP029256.1 | Christensenella minuta |
| 115 | 2342002 | 2342292 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 116 | 218546 | 218836 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 117 | 160037 | 160327 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 118 | 3242332 | 3242616 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 119 | 54053 | 54343 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 120 | 2747653 | 2747943 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 121 | 2162871 | 2163158 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 122 | 1983512 | 1983778 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 123 | 50111 | 50401 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 124 | 3186692 | 3186982 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 125 | 1790697 | 1790984 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 126 | 429122 | 429412 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 127 | 3175357 | 3175647 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 128 | 561021 | 561311 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 129 | 53834 | 54118 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 130 | 131891 | 132181 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 131 | 200094 | 200402 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 132 | 2274778 | 2275065 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 133 | 1085593 | 1085886 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 134 | 697037 | 697321 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 135 | 2505125 | 2505391 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 136 | 2858891 | 2859148 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 137 | 50911 | 51204 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 138 | 50175 | 50468 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 139 | 50145 | 50438 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 140 | 55623 | 55913 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 141 | 5069106 | 5069399 | - | NZ_CP040336.1 | Bacillus luti |
| 142 | 4653338 | 4653634 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 143 | 52808 | 53101 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 144 | 45516 | 45776 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 145 | 167757 | 168047 | + | NZ_CP053989.1 | Niallia circulans |
| 146 | 53377 | 53670 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 147 | 50523 | 50816 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 148 | 50418 | 50711 | + | NC_011725.1 | Bacillus cereus B4264 |
| 149 | 38147 | 38431 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 150 | 56076 | 56366 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 151 | 191703 | 191996 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 152 | 55745 | 56038 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 153 | 55561 | 55854 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 154 | 55554 | 55847 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 155 | 36127 | 36420 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 156 | 1953568 | 1953861 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 157 | 52590 | 52883 | + | NZ_LS483476.1 | Lederbergia lentus |
| 158 | 171978 | 172274 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 159 | 44095 | 44385 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 160 | 1573440 | 1573736 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 161 | 34793 | 35089 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 162 | 1490385 | 1490681 | - | NZ_CP043404.1 | Bacillus safensis |
| 163 | 3874287 | 3874580 | - | NZ_CP011937.1 | Bacillus velezensis |
| 164 | 56963 | 57256 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 165 | 60492 | 60785 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 166 | 87112 | 87405 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 167 | 63244 | 63537 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 168 | 4132672 | 4132962 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 169 | 57480 | 57770 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 170 | 2810696 | 2810980 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 171 | 2035529 | 2035822 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 172 | 1838044 | 1838334 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 173 | 3152212 | 3152499 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 174 | 2480167 | 2480448 | - | NZ_LN879430.1 | Herbinix luporum |
| 175 | 59407 | 59700 | + | NZ_CP012024.1 | Bacillus smithii |
| 176 | 3573356 | 3573628 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 177 | 64304 | 64591 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 178 | 2484460 | 2484729 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 179 | 2580128 | 2580424 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 180 | 5622825 | 5623112 | - | NZ_CP039126.1 | Blautia producta |
| 181 | 55866 | 56159 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 182 | 4496924 | 4497208 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 183 | 58791 | 59081 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 184 | 2861794 | 2862060 | - | NZ_LR699011.1 | Roseburia hominis |
| 185 | 2215688 | 2215975 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 186 | 2732913 | 2733200 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 187 | 174988 | 175278 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 188 | 1536303 | 1536596 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 189 | 65978 | 66271 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 190 | 81916 | 82212 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 191 | 3744096 | 3744380 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 192 | 448732 | 449019 | - | NZ_CP026363.1 | Brevibacillus agri |
| 193 | 3176818 | 3177102 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 194 | 3855768 | 3856058 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 195 | 268322 | 268615 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 196 | 5619494 | 5619781 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 197 | 3518923 | 3519219 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 198 | 825270 | 825557 | + | NZ_CP034437.1 | Paenibacillus albus |
| 199 | 216232 | 216516 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 200 | 5342759 | 5343043 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 201 | 3582378 | 3582662 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 202 | 5295376 | 5295660 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 203 | 178293 | 178583 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 204 | 37466 | 37753 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 205 | 80114 | 80407 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 206 | 894787 | 895074 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 207 | 4777651 | 4777953 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 208 | 2147145 | 2147444 | - | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 209 | 1475476 | 1475754 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 210 | 146427 | 146708 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 211 | 3194665 | 3194949 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 212 | 77256 | 77558 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 213 | 4644235 | 4644537 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 214 | 4140962 | 4141246 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 215 | 980919 | 981203 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 216 | 1636244 | 1636531 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 217 | 7098857 | 7099144 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 218 | 296171 | 296455 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 219 | 8460334 | 8460621 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 220 | 2240401 | 2240694 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 221 | 2315558 | 2315845 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 222 | 1745541 | 1745825 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 223 | 128779 | 129066 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 224 | 551997 | 552296 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 225 | 49494 | 49781 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 226 | 1044568 | 1044828 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 227 | 1949460 | 1949747 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 228 | 36989 | 37276 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 229 | 1909307 | 1909594 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 230 | 37062 | 37349 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 231 | 37083 | 37367 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 232 | 40749 | 41033 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 233 | 37201 | 37485 | + | NZ_CP009288.1 | Paenibacillus durus |
| 234 | 61360 | 61653 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 235 | 1823824 | 1824111 | - | NZ_CP070062.1 | Coprococcus comes |
| 236 | 1262567 | 1262836 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 237 | 3823943 | 3824227 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 238 | 373750 | 374037 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 239 | 389695 | 389991 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 240 | 2308855 | 2309142 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 241 | 70647 | 70937 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 242 | 686931 | 687215 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 243 | 3949741 | 3950028 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 244 | 2093225 | 2093509 | + | NZ_CP048649.1 | Aminipila butyrica |
| 245 | 143040 | 143324 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 246 | 122673 | 122951 | + | NZ_CP019870.1 | Clostridioides difficile |
| 247 | 229000 | 229281 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 248 | 57353 | 57637 | + | NZ_AP019400.1 | Cohnella abietis |
| 249 | 4279612 | 4279896 | + | NZ_CP033433.1 | Cohnella candidum |
| 250 | 1680176 | 1680472 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 251 | 1510531 | 1510815 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 252 | 1662609 | 1662893 | + | NZ_CP021434.1 | Tumebacillus avium |
| 253 | 202475 | 202759 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 254 | 4482030 | 4482317 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 255 | 154161 | 154439 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 256 | 135126 | 135428 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 257 | 1958330 | 1958608 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 258 | 3561041 | 3561319 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 259 | 1534541 | 1534825 | + | NC_023035.1 | Salinispira pacifica |
| 260 | 96095 | 96388 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 261 | 1736194 | 1736475 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 262 | 114770 | 115057 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 263 | 870308 | 870589 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
| 264 | 2099663 | 2099941 | + | NZ_CP031518.1 | Treponema ruminis |
| 265 | 20491 | 20775 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 266 | 1128044 | 1128334 | - | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 267 | 884584 | 884838 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 268 | 1065495 | 1065779 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 269 | 3110726 | 3111007 | + | NC_015578.1 | Treponema primitia ZAS-2 |
| 270 | 112756 | 113019 | + | NC_022538.1 | Acholeplasma palmae J233 |
| 271 | 1548111 | 1548398 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 272 | 25515 | 25790 | + | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 273 | 158901 | 159185 | + | NZ_AP019829.2 | Leptotrichia wadei |
| 274 | 63837 | 64124 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 275 | 2093829 | 2094119 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 276 | 2685432 | 2685713 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 277 | 3287045 | 3287329 | + | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 278 | 90104 | 90382 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 279 | 2714325 | 2714606 | - | NZ_CP009228.1 | Treponema putidum |
| 280 | 63367 | 63654 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 281 | 2004544 | 2004828 | - | NZ_AP019827.1 | Leptotrichia shahii |
| 282 | 2133421 | 2133705 | - | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 283 | 1728060 | 1728347 | - | NZ_CP054142.1 | Treponema parvum |
| 284 | 2430468 | 2430746 | - | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 285 | 3321902 | 3322141 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 286 | 2113594 | 2113878 | - | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 287 | 2689857 | 2690153 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 288 | 2628710 | 2628985 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 289 | 2180390 | 2180677 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 290 | 19383 | 19667 | + | NZ_AP019845.1 | Leptotrichia trevisanii |
| 291 | 654108 | 654362 | + | NC_021169.1 | Archaeoglobus sulfaticallidus PM70-1 |
| 292 | 194103 | 194360 | - | NC_015320.1 | Archaeoglobus veneficus SNP6 |
| 293 | 1922162 | 1922401 | + | NC_013849.1 | Ferroglobus placidus DSM 10642 |
| 294 | 94593 | 94877 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 295 | 641171 | 641425 | - | NZ_CP011267.1 | Geoglobus ahangari |
| 296 | 245059 | 245340 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
| 297 | 2363892 | 2364173 | + | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP022121.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00288.28 | 0.62 | 184 | 1457 | same-strand | GHMP kinases N terminal domain |
| 2 | PF00132.26 | 0.84 | 249 | 207 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 3 | PF00483.25 | 0.83 | 245 | 209.0 | same-strand | Nucleotidyl transferase |
| 4 | PF14602.8 | 0.75 | 220 | 209 | same-strand | Hexapeptide repeat of succinyl-transferase |
| 5 | PF13793.8 | 0.77 | 228 | 1639 | same-strand | N-terminal domain of ribose phosphate pyrophosphokinase |
| 6 | PF01195.21 | 0.69 | 204 | 3413 | same-strand | Peptidyl-tRNA hydrolase |
| 7 | PF09182.12 | 0.76 | 225 | 458.0 | same-strand | Bacterial purine repressor, N-terminal |
++ More..