Result : A0Q119
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000382.1 |
| Organism | Clostridium novyi (strain NT) |
| Left | 1439444 |
| Right | 1439665 |
| Strand | - |
| Nucleotide Sequence | ATGAACAATTATATGATTAATCCATCAATTGTAGATTTATTAACTAAAGTTGACAACAGATACTCACTAGTTACTGTAACATCTAGAAGAGCAAGACAAATAATAGATGGAGATGAAGCTTTAGTAAATGTAGAAGATGCATATAAACCACTTACAACAGCAATACATGAAGTAAATGCTGGAAAAGTTTCTTATGAGTCTTTAGTGGAGGGAATAAAATAG |
| Sequence | MNNYMINPSIVDLLTKVDNRYSLVTVTSRRARQIIDGDEALVNVEDAYKPLTTAIHEVNAGKVSYESLVEGIK |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 17115055 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | A0Q119 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 34
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1439444 | 1439665 | - | NC_008593.1 | Clostridium novyi NT |
| 2 | 1810100 | 1810318 | + | NZ_CP040924.1 | Clostridium thermarum |
| 3 | 1018933 | 1019151 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 4 | 223319 | 223537 | - | NZ_CP023671.1 | Clostridium septicum |
| 5 | 1834224 | 1834442 | + | NZ_CP014176.1 | Clostridium argentinense |
| 6 | 1404737 | 1404955 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 7 | 1723871 | 1724089 | - | NZ_CP014204.2 | Clostridium baratii |
| 8 | 1842906 | 1843124 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 9 | 2597592 | 2597810 | - | NZ_CP028842.1 | Clostridium botulinum |
| 10 | 2856182 | 2856400 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 11 | 1241458 | 1241676 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 12 | 3589349 | 3589567 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 13 | 1353293 | 1353511 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 14 | 1164869 | 1165069 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 15 | 110220 | 110438 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 16 | 3118913 | 3119131 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 17 | 1149085 | 1149303 | + | NZ_CP020953.1 | Clostridium drakei |
| 18 | 1157282 | 1157500 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 19 | 2941208 | 2941426 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 20 | 1522167 | 1522373 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 21 | 2254999 | 2255220 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 22 | 1537855 | 1538073 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 23 | 2240410 | 2240622 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 24 | 2248439 | 2248657 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 25 | 1357873 | 1358091 | + | NZ_CP043998.1 | Clostridium diolis |
| 26 | 1411164 | 1411382 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 27 | 2114346 | 2114564 | - | NZ_HG917868.1 | Clostridium bornimense |
| 28 | 1869485 | 1869703 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 29 | 1123730 | 1123951 | + | NZ_CP030775.1 | Clostridium butyricum |
| 30 | 3719070 | 3719306 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 31 | 344254 | 344457 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 32 | 1100474 | 1100680 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 33 | 1462649 | 1462831 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 34 | 2806623 | 2806829 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008593.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04298.14 | 0.71 | 24 | 4952.0 | same-strand | Putative neutral zinc metallopeptidase |
| 2 | PF00551.21 | 0.97 | 33 | 3980 | same-strand | Formyl transferase |
| 3 | PF02911.20 | 0.97 | 33 | 3980 | same-strand | Formyl transferase, C-terminal domain |
| 4 | PF01327.23 | 0.97 | 33 | 3509 | same-strand | Polypeptide deformylase |
| 5 | PF17764.3 | 0.97 | 33 | 1263 | same-strand | 3'DNA-binding domain (3'BD) |
| 6 | PF18074.3 | 0.97 | 33 | 1273 | same-strand | Primosomal protein N C-terminal domain |
| 7 | PF04851.17 | 0.97 | 33 | 1273 | same-strand | Type III restriction enzyme, res subunit |
| 8 | PF00270.31 | 0.97 | 33 | 1273 | same-strand | DEAD/DEAH box helicase |
| 9 | PF18319.3 | 0.97 | 33 | 1273 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 10 | PF04127.17 | 1.0 | 34 | 2.0 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 11 | PF02441.21 | 1.0 | 34 | 2.0 | same-strand | Flavoprotein |
| 12 | PF00625.23 | 1.0 | 34 | -19.0 | same-strand | Guanylate kinase |
| 13 | PF13238.8 | 0.97 | 33 | -19 | same-strand | AAA domain |
| 14 | PF04025.14 | 1.0 | 34 | 614.5 | same-strand | Domain of unknown function (DUF370) |
| 15 | PF03755.15 | 1.0 | 34 | 904.5 | same-strand | YicC-like family, N-terminal region |
| 16 | PF08340.13 | 1.0 | 34 | 904.5 | same-strand | Domain of unknown function (DUF1732) |
++ More..