Result : EXP00386
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00386 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 2167838 |
| Right | 2168062 |
| Strand | - |
| Nucleotide Sequence | ATGAGGCAGGGCGTTCTGGGGATCGTGGCGATCAGCCTCCTGGCTGGGTGCTCGACCTGGGGCGAAAGCATTCCGCGGCCGCCTGAGCGGACGCTGGAGGACAAGGTCGAGGCGCGCCGCAAGGCTGACGACAAGACCAAAAAGTGTGTCCTCGAGCAGACGTTGCGGCGGCAGCAAAAAGAGCAGGGTAGGGACGTCCGTCCCCTCCCTAAGGAAAAGTGTTAG |
| Sequence | MRQGVLGIVAISLLAGCSTWGESIPRPPERTLEDKVEARRKADDKTKKCVLEQTLRRQQKEQGRDVRPLPKEKC |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2167838 | 2168062 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 2442160 | 2442384 | - | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 3178315 | 3178506 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP027850.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00361.22 | 1.0 | 3 | 2548.5 | same-strand | Proton-conducting membrane transporter |
| 2 | PF00662.22 | 1.0 | 3 | 1513 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
| 3 | PF00420.26 | 1.0 | 3 | 1200 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 4L |
| 4 | PF00499.22 | 1.0 | 3 | 586 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 6 |
| 5 | PF00037.29 | 1.0 | 3 | 11 | same-strand | 4Fe-4S binding domain |
| 6 | PF12838.9 | 1.0 | 3 | 11 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF13187.8 | 1.0 | 3 | 11 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF13237.8 | 1.0 | 3 | 11 | same-strand | 4Fe-4S dicluster domain |
| 9 | PF13183.8 | 1.0 | 3 | 11 | same-strand | 4Fe-4S dicluster domain |
| 10 | PF12800.9 | 1.0 | 3 | 11 | same-strand | 4Fe-4S binding domain |
| 11 | PF00146.23 | 1.0 | 3 | 236 | same-strand | NADH dehydrogenase |
| 12 | PF00384.24 | 1.0 | 3 | 1311 | same-strand | Molybdopterin oxidoreductase |
| 13 | PF10588.11 | 1.0 | 3 | 1311 | same-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
| 14 | PF13510.8 | 1.0 | 3 | 1311 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 15 | PF01512.19 | 1.0 | 3 | 3377 | same-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
| 16 | PF10589.11 | 1.0 | 3 | 3377 | same-strand | NADH-ubiquinone oxidoreductase-F iron-sulfur binding region |
| 17 | PF10531.11 | 1.0 | 3 | 3377 | same-strand | SLBB domain |
| 18 | PF14697.8 | 0.67 | 2 | 11.0 | same-strand | 4Fe-4S dicluster domain |
| 19 | PF09326.13 | 0.67 | 2 | 1334.5 | same-strand | NADH-ubiquinone oxidoreductase subunit G, C-terminal |
++ More..