Result : EXP00382
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00382 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 1021470 |
| Right | 1021586 |
| Strand | - |
| Nucleotide Sequence | ATGAATTTCAATGGCTTGGCACATCATCGGGGATCATGCCCCACCGCGACCCGGCAAGTTTCGCCGGGCAACGACGCATCATGCGTTGCGCGGTTTGCCGAGCCGAAGGAGGCCTGA |
| Sequence | MNFNGLAHHRGSCPTATRQVSPGNDASCVARFAEPKEA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1021470 | 1021586 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 3714251 | 3714379 | + | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 2626312 | 2626431 | - | NZ_CP026100.1 | Caulobacter flavus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP027850.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03054.18 | 1.0 | 3 | 3087 | same-strand | tRNA methyl transferase |
| 2 | PF00700.23 | 1.0 | 3 | 2117 | same-strand | Bacterial flagellin C-terminal helical region |
| 3 | PF00669.22 | 0.67 | 2 | 2112.5 | same-strand | Bacterial flagellin N-terminal helical region |
| 4 | PF00460.22 | 1.0 | 3 | 1381.5 | both-strands | Flagella basal body rod protein |
| 5 | PF02120.18 | 1.0 | 3 | 296 | opposite-strand | Flagellar hook-length control protein FliK |
| 6 | PF13860.8 | 1.0 | 3 | 2079 | opposite-strand | FlgD Ig-like domain |
| 7 | PF03963.16 | 1.0 | 3 | 2079 | opposite-strand | Flagellar hook capping protein - N-terminal region |
| 8 | PF06429.15 | 1.0 | 3 | 2909 | opposite-strand | Flagellar basal body rod FlgEFG protein C-terminal |
| 9 | PF07559.16 | 1.0 | 3 | 2909 | opposite-strand | Flagellar basal body protein FlaE |
| 10 | PF06627.13 | 1.0 | 3 | 4853 | opposite-strand | Protein of unknown function (DUF1153) |
| 11 | PF01514.19 | 0.67 | 2 | 5329.5 | opposite-strand | Secretory protein of YscJ/FliF family |
| 12 | PF08345.13 | 0.67 | 2 | 5329.5 | opposite-strand | Flagellar M-ring protein C-terminal |
| 13 | PF13861.8 | 0.67 | 2 | 2028.0 | opposite-strand | FlgD Tudor-like domain |
++ More..