Result : B1HZH6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0346 protein Bsph_2735 |
| NCBI Accession ID | CP000817.1 |
| Organism | Lysinibacillus sphaericus (strain C3-41) |
| Left | 2703388 |
| Right | 2703609 |
| Strand | + |
| Nucleotide Sequence | GTGATGAAAAAAAGTTTTTATTTATATGTCCTAACATTTCGGGGCGGCGACTGGTCAGACCCTAAGGTACGGTTTGCAGAGGAAATGTTTCATGAGCATAATTTTCCAAAGCAAAGCACAGACTTTAACGAACTATCCAACTACATTGAATCCTATGCTACAGAAAATTTAACAATTGAAGCTTTTGATCATTTGTGGGAATTATATGAGGGACAGGCATAA |
| Sequence | MMKKSFYLYVLTFRGGDWSDPKVRFAEEMFHEHNFPKQSTDFNELSNYIESYATENLTIEAFDHLWELYEGQA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
| Pubmed ID | 18296527 |
| Domain | CDD:416295 |
| Functional Category | Others |
| Uniprot ID | B1HZH6 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2605420 | 2605641 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 2 | 2419738 | 2419959 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 3 | 2219351 | 2219572 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 4 | 1890705 | 1890926 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 5 | 1711389 | 1711619 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 6 | 1606937 | 1607155 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 7 | 784779 | 784997 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 8 | 2333994 | 2334212 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 9 | 1085558 | 1085776 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
++ More..