Result : EXP00373
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00373 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 770292 |
| Right | 770423 |
| Strand | - |
| Nucleotide Sequence | ATGTCGTTCGTGCGTTTGCAGTCTTCACACCATCGCCGCCGGCTGCCCCGCCCGTCGGTGGTGATCCTGGGCCTGTCGGTCTGGCTGGTGCTGGGCCTGATCAGCCAGGCGGCGTTCCGGCTGATCGGCTAA |
| Sequence | MSFVRLQSSHHRRRLPRPSVVILGLSVWLVLGLISQAAFRLIG |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 770292 | 770423 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 541275 | 541406 | - | NZ_CP013002.1 | Caulobacter henricii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11775.10 | 1.0 | 2 | 2561.0 | same-strand | Cobalamin biosynthesis protein CobT VWA domain |
| 2 | PF06213.14 | 1.0 | 2 | 2561.0 | same-strand | Cobalamin biosynthesis protein CobT |
| 3 | PF07043.15 | 1.0 | 2 | 2275.0 | opposite-strand | Protein of unknown function (DUF1328) |
| 4 | PF11288.10 | 1.0 | 2 | 1027.0 | same-strand | Protein of unknown function (DUF3089) |
++ More..