Result : B1HQE0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000817.1 |
| Organism | Lysinibacillus sphaericus (strain C3-41) |
| Left | 1578317 |
| Right | 1578544 |
| Strand | + |
| Nucleotide Sequence | ATGTTATACCCATCAGTAGATGCTTTAAAAAAAGAAATCGATTCAAAATATTCACTAGTGAGCCTTGCTTCAAAACGTGCTCGTCAAATGCAGGAAGAGCAAAATACAGAACGTTTACACAAGTACGTATCTCATAAATACGTAGGAAAAGCACTTGAAGAAGTAGCGGCAGGTGTTCTTACGAAAGTATCACAGGATGAGTCAACTGTGTACGAAGACGAAATCTAA |
| Sequence | MLYPSVDALKKEIDSKYSLVSLASKRARQMQEEQNTERLHKYVSHKYVGKALEEVAAGVLTKVSQDESTVYEDEI |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 18296527 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | B1HQE0 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 101
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3782912 | 3783139 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 2 | 1013260 | 1013487 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 3 | 3657282 | 3657509 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 4 | 2075105 | 2075329 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 5 | 1797141 | 1797365 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 6 | 3307362 | 3307586 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 7 | 2001466 | 2001690 | - | NZ_CP016538.2 | Planococcus maritimus |
| 8 | 2999902 | 3000126 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 9 | 2024709 | 2024933 | - | NZ_CP059540.1 | Planococcus maritimus |
| 10 | 1978917 | 1979141 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 11 | 2989203 | 2989427 | + | NZ_CP013661.2 | Planococcus kocurii |
| 12 | 2274264 | 2274488 | - | NZ_CP019401.1 | Planococcus faecalis |
| 13 | 2415106 | 2415330 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 14 | 1437212 | 1437436 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 15 | 2229569 | 2229793 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 16 | 2126263 | 2126487 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 17 | 2139978 | 2140202 | - | NZ_CP016540.2 | Planococcus versutus |
| 18 | 1818852 | 1819076 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 19 | 2570441 | 2570665 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 20 | 1322000 | 1322227 | + | NZ_CP012024.1 | Bacillus smithii |
| 21 | 1516196 | 1516423 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 22 | 1626647 | 1626853 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 23 | 107318 | 107524 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 24 | 2404825 | 2405025 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 25 | 1016176 | 1016376 | + | NZ_LR134483.1 | Listeria grayi |
| 26 | 4995586 | 4995807 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 27 | 179681 | 179905 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 28 | 3426240 | 3426440 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 29 | 1010059 | 1010268 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 30 | 1640371 | 1640565 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 31 | 1293683 | 1293889 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 32 | 2699972 | 2700178 | - | NZ_LS483476.1 | Lederbergia lentus |
| 33 | 996677 | 996874 | + | NZ_CP046314.1 | Gemella morbillorum |
| 34 | 4189187 | 4189393 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 35 | 991263 | 991469 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 36 | 1533045 | 1533248 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 37 | 2117209 | 2117427 | + | NZ_CP053989.1 | Niallia circulans |
| 38 | 2024414 | 2024635 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 39 | 1902281 | 1902484 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 40 | 1860455 | 1860658 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 41 | 1956270 | 1956473 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 42 | 2615779 | 2615991 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 43 | 1875917 | 1876120 | - | NZ_LT906444.1 | Listeria welshimeri |
| 44 | 2603749 | 2603958 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 45 | 1770415 | 1770615 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 46 | 1471807 | 1472019 | + | NZ_CP040336.1 | Bacillus luti |
| 47 | 2363652 | 2363855 | - | NZ_CP011937.1 | Bacillus velezensis |
| 48 | 1597291 | 1597494 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 49 | 3892469 | 3892681 | - | NC_011725.1 | Bacillus cereus B4264 |
| 50 | 1820926 | 1821129 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 51 | 1549964 | 1550167 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 52 | 1646645 | 1646848 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 53 | 1609107 | 1609310 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 54 | 1615437 | 1615640 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 55 | 343373 | 343576 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 56 | 1642567 | 1642770 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 57 | 2124672 | 2124884 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 58 | 1748378 | 1748578 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 59 | 154653 | 154856 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 60 | 869591 | 869791 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 61 | 1770980 | 1771180 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 62 | 1172251 | 1172445 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 63 | 3687924 | 3688136 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 64 | 1544613 | 1544816 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 65 | 624987 | 625199 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 66 | 1545775 | 1545966 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 67 | 3896755 | 3896967 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 68 | 3757478 | 3757690 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 69 | 2125078 | 2125290 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 70 | 1581718 | 1581930 | - | NZ_CP014164.1 | Aerococcus viridans |
| 71 | 1133165 | 1133365 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 72 | 2344684 | 2344866 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 73 | 1624572 | 1624781 | - | NZ_CP034118.1 | Staphylospora marina |
| 74 | 1394823 | 1395017 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 75 | 1525171 | 1525371 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 76 | 323663 | 323848 | - | NZ_CP014159.1 | Aerococcus christensenii |
| 77 | 1746233 | 1746445 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 78 | 1888412 | 1888615 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 79 | 985923 | 986123 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 80 | 2006904 | 2007098 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 81 | 1247770 | 1247964 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 82 | 1811839 | 1812051 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 83 | 1770032 | 1770244 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 84 | 646783 | 646986 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 85 | 970752 | 970952 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 86 | 2137295 | 2137510 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 87 | 2454619 | 2454816 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 88 | 1098891 | 1099109 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 89 | 3366278 | 3366487 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 90 | 1113008 | 1113205 | - | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 91 | 1661282 | 1661494 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 92 | 3940617 | 3940829 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 93 | 1269304 | 1269522 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 94 | 410165 | 410362 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 95 | 82363 | 82557 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 96 | 339096 | 339299 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 97 | 2301174 | 2301407 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 98 | 1160301 | 1160492 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 99 | 4434300 | 4434515 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 100 | 1117092 | 1117301 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 101 | 2249248 | 2249469 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 102 | 1527400 | 1527582 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP038015.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01189.19 | 0.94 | 95 | 5144.0 | same-strand | 16S rRNA methyltransferase RsmB/F |
| 2 | PF01029.20 | 0.94 | 95 | 5144.0 | same-strand | NusB family |
| 3 | PF00551.21 | 0.96 | 97 | 4213.5 | same-strand | Formyl transferase |
| 4 | PF02911.20 | 0.96 | 97 | 4213.5 | same-strand | Formyl transferase, C-terminal domain |
| 5 | PF17764.3 | 0.97 | 98 | 1333 | same-strand | 3'DNA-binding domain (3'BD) |
| 6 | PF18074.3 | 0.97 | 98 | 1333 | same-strand | Primosomal protein N C-terminal domain |
| 7 | PF04851.17 | 0.97 | 98 | 1333 | same-strand | Type III restriction enzyme, res subunit |
| 8 | PF00270.31 | 0.97 | 98 | 1333 | same-strand | DEAD/DEAH box helicase |
| 9 | PF18319.3 | 0.97 | 98 | 1333 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 10 | PF02441.21 | 0.91 | 92 | 132 | same-strand | Flavoprotein |
| 11 | PF00625.23 | 1.0 | 101 | 3 | same-strand | Guanylate kinase |
| 12 | PF05833.13 | 0.68 | 69 | 4526.0 | opposite-strand | NFACT N-terminal and middle domains |
| 13 | PF05670.15 | 0.68 | 69 | 4526.0 | opposite-strand | NFACT protein RNA binding domain |
| 14 | PF04127.17 | 0.87 | 88 | 128 | same-strand | DNA / pantothenate metabolism flavoprotein |
++ More..