Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00368 |
NCBI Accession ID | NC_011916.1 |
Organism | Caulobacter vibrioides NA1000 |
Left | 256240 |
Right | 256344 |
Strand | - |
Nucleotide Sequence | ATGCGTACACCGAATAAACCGCTCTTCAAGGCCTACGAACTGGTGGCGATCGCCGTCTTCGTCGTGGCGGCCGCCGCTGTCAGCAGCATCGGCCTTGTATACTAG |
Sequence | MRTPNKPLFKAYELVAIAVFVVAAAAVSSIGLVY |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 25078267 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 34 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 256240 | 256344 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
2 | 4092321 | 4092425 | - | NZ_CP024201.1 | Caulobacter mirabilis |
3 | 5498786 | 5498890 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
4 | 248601 | 248705 | - | NZ_CP013002.1 | Caulobacter henricii |
5 | 1040551 | 1040655 | + | NZ_CP026100.1 | Caulobacter flavus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01329.21 | 0.6 | 3 | 1316 | opposite-strand | Pterin 4 alpha carbinolamine dehydratase |
2 | PF13561.8 | 0.8 | 4 | 1757.5 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
3 | PF00106.27 | 0.8 | 4 | 1757.5 | opposite-strand | short chain dehydrogenase |
4 | PF08659.12 | 0.8 | 4 | 1757.5 | opposite-strand | KR domain |