Result : EXP00368
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00368 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 256240 |
| Right | 256344 |
| Strand | - |
| Nucleotide Sequence | ATGCGTACACCGAATAAACCGCTCTTCAAGGCCTACGAACTGGTGGCGATCGCCGTCTTCGTCGTGGCGGCCGCCGCTGTCAGCAGCATCGGCCTTGTATACTAG |
| Sequence | MRTPNKPLFKAYELVAIAVFVVAAAAVSSIGLVY |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 256240 | 256344 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 4092321 | 4092425 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 3 | 5498786 | 5498890 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 4 | 248601 | 248705 | - | NZ_CP013002.1 | Caulobacter henricii |
| 5 | 1040551 | 1040655 | + | NZ_CP026100.1 | Caulobacter flavus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01329.21 | 0.6 | 3 | 1316 | opposite-strand | Pterin 4 alpha carbinolamine dehydratase |
| 2 | PF13561.8 | 0.8 | 4 | 1757.5 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 3 | PF00106.27 | 0.8 | 4 | 1757.5 | opposite-strand | short chain dehydrogenase |
| 4 | PF08659.12 | 0.8 | 4 | 1757.5 | opposite-strand | KR domain |
++ More..