Result : EXP00364
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00364 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 3815979 |
| Right | 3816086 |
| Strand | - |
| Nucleotide Sequence | ATGGCCAAGGGTCAGAAGAAGTCCAACAAGGAAATCCGCAAACCGAAGGCCGAAAAGAAGCCGCCGCCCGCGCAGGTCTCGCCGTTCATCGTGACGGGGAAGAAGTAA |
| Sequence | MAKGQKKSNKEIRKPKAEKKPPPAQVSPFIVTGKK |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3815979 | 3816086 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 161318 | 161425 | + | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 120154 | 120264 | + | NZ_CP013002.1 | Caulobacter henricii |
| 4 | 5293331 | 5293441 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 5 | 2521579 | 2521692 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 6 | 3684101 | 3684211 | - | NZ_CP053073.1 | Usitatibacter palustris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00580.23 | 0.67 | 4 | 602.5 | opposite-strand | UvrD/REP helicase N-terminal domain |
| 2 | PF13245.8 | 0.67 | 4 | 602.5 | opposite-strand | AAA domain |
| 3 | PF00085.22 | 0.67 | 4 | 141.0 | opposite-strand | Thioredoxin |
| 4 | PF13098.8 | 0.67 | 4 | 141.0 | opposite-strand | Thioredoxin-like domain |
++ More..