Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00364 |
NCBI Accession ID | NC_011916.1 |
Organism | Caulobacter vibrioides NA1000 |
Left | 3815979 |
Right | 3816086 |
Strand | - |
Nucleotide Sequence | ATGGCCAAGGGTCAGAAGAAGTCCAACAAGGAAATCCGCAAACCGAAGGCCGAAAAGAAGCCGCCGCCCGCGCAGGTCTCGCCGTTCATCGTGACGGGGAAGAAGTAA |
Sequence | MAKGQKKSNKEIRKPKAEKKPPPAQVSPFIVTGKK |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 25078267 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 35 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3815979 | 3816086 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
2 | 161318 | 161425 | + | NZ_CP027850.1 | Caulobacter segnis |
3 | 120154 | 120264 | + | NZ_CP013002.1 | Caulobacter henricii |
4 | 5293331 | 5293441 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
5 | 2521579 | 2521692 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
6 | 3684101 | 3684211 | - | NZ_CP053073.1 | Usitatibacter palustris |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00580.23 | 0.67 | 4 | 602.5 | opposite-strand | UvrD/REP helicase N-terminal domain |
2 | PF13245.8 | 0.67 | 4 | 602.5 | opposite-strand | AAA domain |
3 | PF00085.22 | 0.67 | 4 | 141.0 | opposite-strand | Thioredoxin |
4 | PF13098.8 | 0.67 | 4 | 141.0 | opposite-strand | Thioredoxin-like domain |