Result : EXP00360

Protein Information

• Protein name: EXP00360
• NCBI Accession ID: NC_011916.1
• Organism: Caulobacter vibrioides NA1000
• Left: 3355502
• Right: 3355606
• Strand: +
• Nucleotide Sequence: ATGCGTTACCGCTCTTCAAACTGCCGCAGCGTGAACTATCTACCCTCCTGTGTGGGGGATGATCGCGCGCGATTGGCGAGCGGATCCGCACGCAAGGGGATATGA
• Sequence: MRYRSSNCRSVNYLPSCVGDDRARLASGSARKGI
• Source of smORF: Ribo-seq
• Pubmed ID: 25078267
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 34

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3355502	3355606	+	NC_011916.1	Caulobacter vibrioides NA1000
2	928049	928153	-	NZ_CP027850.1	Caulobacter segnis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_011916.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01212.23	1.0	2	3280.5	same-strand	Beta-eliminating lyase
2	PF00563.22	1.0	2	1228.0	opposite-strand	EAL domain
3	PF00990.23	1.0	2	1228.0	opposite-strand	Diguanylate cyclase, GGDEF domain
4	PF04020.15	1.0	2	87.0	opposite-strand	Mycobacterial 4 TMS phage holin, superfamily IV
5	PF04545.18	1.0	2	6.0	same-strand	Sigma-70, region 4
6	PF04542.16	1.0	2	6.0	same-strand	Sigma-70 region 2
7	PF00140.22	1.0	2	6.0	same-strand	Sigma-70 factor, region 1.2
8	PF12697.9	1.0	2	1237.0	same-strand	Alpha/beta hydrolase family
9	PF00072.26	1.0	2	4304	opposite-strand	Response regulator receiver domain