Result : B1HPT4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0223 protein Bsph_1378 |
| NCBI Accession ID | CP000817.1 |
| Organism | Lysinibacillus sphaericus (strain C3-41) |
| Left | 1475343 |
| Right | 1475630 |
| Strand | + |
| Nucleotide Sequence | ATGGAATATTCTTATCCGTTTTCAACAGATTGGTCTACAGAGGAGATTGTGGATGTTGTTCAATTTTTTGAAGGAATTGAACAAGCTCATGAAAAGGGCATCAAGCGTGAGGTTATGATGGCTAAATATCGCCGCTTTAAGGAAATTGTTCCTTCACAGGCTGAGGAAAAAACAATCTTTCGTGAATTTGAAGAAGCGAGTGGCTATATTAGCTATCCTGTTGTTAAACAAACAAAAGAAGCCGCAGATGGTACAATTATAAAAATAGTCCCTAAAAAAAATCGATAA |
| Sequence | MEYSYPFSTDWSTEEIVDVVQFFEGIEQAHEKGIKREVMMAKYRRFKEIVPSQAEEKTIFREFEEASGYISYPVVKQTKEAADGTIIKIVPKKNR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23825. Profile Description: Uncharacterized protein family (UPF0223). hypothetical protein; Provisional |
| Pubmed ID | 18296527 |
| Domain | CDD:420035 |
| Functional Category | Others |
| Uniprot ID | B1HPT4 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 86
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3886035 | 3886322 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 2 | 893750 | 894037 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 3 | 3775907 | 3776194 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 4 | 1252578 | 1252847 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 5 | 2158783 | 2159061 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 6 | 2052149 | 2052418 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 7 | 1870540 | 1870815 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 8 | 2075490 | 2075765 | - | NZ_CP016538.2 | Planococcus maritimus |
| 9 | 2097830 | 2098105 | - | NZ_CP059540.1 | Planococcus maritimus |
| 10 | 2214494 | 2214772 | - | NZ_CP016540.2 | Planococcus versutus |
| 11 | 2304846 | 2305124 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 12 | 2906257 | 2906529 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 13 | 2695302 | 2695571 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 14 | 2913209 | 2913487 | + | NZ_CP013661.2 | Planococcus kocurii |
| 15 | 1337063 | 1337332 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 16 | 2350210 | 2350488 | - | NZ_CP019401.1 | Planococcus faecalis |
| 17 | 12746 | 13033 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 18 | 2200394 | 2200672 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 19 | 2491362 | 2491640 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 20 | 1230481 | 1230762 | + | NZ_CP012024.1 | Bacillus smithii |
| 21 | 2275338 | 2275634 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 22 | 1619089 | 1619361 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 23 | 1555275 | 1555550 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 24 | 488206 | 488478 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 25 | 918242 | 918511 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 26 | 1676791 | 1677063 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 27 | 1307097 | 1307378 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 28 | 2517959 | 2518252 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 29 | 2474617 | 2474889 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 30 | 1422700 | 1422975 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 31 | 282280 | 282549 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 32 | 2697305 | 2697574 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 33 | 2788666 | 2788935 | - | NZ_LS483476.1 | Lederbergia lentus |
| 34 | 3847914 | 3848183 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 35 | 1656070 | 1656321 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 36 | 1641853 | 1642104 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 37 | 1664461 | 1664712 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 38 | 3405771 | 3406052 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 39 | 256158 | 256424 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 40 | 1463346 | 1463612 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 41 | 1038702 | 1038980 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 42 | 2035735 | 2036007 | + | NZ_CP053989.1 | Niallia circulans |
| 43 | 3989195 | 3989464 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 44 | 1382544 | 1382813 | + | NZ_CP040336.1 | Bacillus luti |
| 45 | 1904340 | 1904612 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 46 | 2657506 | 2657778 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 47 | 3982309 | 3982578 | - | NC_011725.1 | Bacillus cereus B4264 |
| 48 | 3822507 | 3822776 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 49 | 2919588 | 2919866 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 50 | 1539491 | 1539757 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 51 | 1921171 | 1921443 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 52 | 449364 | 449630 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 53 | 4091575 | 4091847 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 54 | 1507795 | 1508061 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 55 | 2208403 | 2208684 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 56 | 2743505 | 2743774 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 57 | 769487 | 769759 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 58 | 1088342 | 1088617 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 59 | 1493598 | 1493864 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 60 | 1502322 | 1502588 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 61 | 2464739 | 2465005 | - | NZ_CP011937.1 | Bacillus velezensis |
| 62 | 1441220 | 1441486 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 63 | 2758294 | 2758560 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 64 | 1712848 | 1713114 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 65 | 218819 | 219091 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 66 | 1535936 | 1536202 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 67 | 69821 | 70093 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 68 | 1691122 | 1691394 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 69 | 1386927 | 1387202 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 70 | 1100667 | 1100939 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 71 | 1755779 | 1756057 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 72 | 1059287 | 1059559 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 73 | 995083 | 995355 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 74 | 717181 | 717453 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 75 | 1085806 | 1086078 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 76 | 2742451 | 2742699 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 77 | 1050806 | 1051078 | + | NZ_LT906444.1 | Listeria welshimeri |
| 78 | 697884 | 698156 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 79 | 1013461 | 1013736 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 80 | 536338 | 536592 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 81 | 405634 | 405909 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 82 | 1568408 | 1568662 | + | NZ_CP027770.1 | Staphylococcus felis |
| 83 | 1125407 | 1125661 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 84 | 1842390 | 1842662 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 85 | 1536470 | 1536739 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 86 | 1074699 | 1074953 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 87 | 1587529 | 1587816 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP038015.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00459.27 | 0.76 | 65 | 1237.5 | same-strand | Inositol monophosphatase family |
| 2 | PF06335.14 | 0.65 | 56 | 62 | opposite-strand | Protein of unknown function (DUF1054) |
| 3 | PF01276.22 | 0.64 | 55 | 1117.0 | opposite-strand | Orn/Lys/Arg decarboxylase, major domain |
| 4 | PF07992.16 | 0.6 | 52 | 2652 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 5 | PF02852.24 | 0.6 | 52 | 2652 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
| 6 | PF00070.29 | 0.6 | 52 | 2652 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
++ More..