Result : EXP00355
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00355 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 2959963 |
| Right | 2960223 |
| Strand | + |
| Nucleotide Sequence | ATGGCCGAAGAGAAGTTCCTGACAACAGAGGAGGTGACTGAGCGCTATCGTGGCGAGGTGTCGGTCGGCACCCTCGAAAACTGGCGCGCTCGACGTATCGGTCCCCCCTTCGTCAAGATCGGCAAGGCCGTGCTCTACCCGATCGAGGAGCTGGATGCTTGGGACCGGCGTAACCTCGTCGCATGCGACGACGCCAAGGTCGTGGGCCGGCGCCGTCAGAAGCCGGGTGAACAAAGCAGCGGGGCGGGCGCGATTGGCTAA |
| Sequence | MAEEKFLTTEEVTERYRGEVSVGTLENWRARRIGPPFVKIGKAVLYPIEELDAWDRRNLVACDDAKVVGRRRQKPGEQSSGAGAIG |
| Source of smORF | Ribo-seq |
| Function | The ORF matches to the profile of cl02600. Profile Description: Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily. This domain is a DNA-binding helix-turn-helix domain. |
| Pubmed ID | 25078267 |
| Domain | CDD:413393 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2959963 | 2960223 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 4190592 | 4190807 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 3 | 3805711 | 3805941 | - | NZ_CP044543.1 | Bradyrhizobium betae |
| 4 | 3901859 | 3902089 | + | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
++ More..