Result : EXP00353
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00353 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 2889997 |
| Right | 2890155 |
| Strand | + |
| Nucleotide Sequence | TTGGCGTTTCGGCGTACAGCACCGTCTCCTGGGACTTCCCCCTTGGGAAGCGCGCCCGAGCCGCCCCGCCGCGCACGCGACTTCGTGAAAACCCAGCTCACCGCCAAGGACGACGCCTCACGGGCTCGTCCTTTTTTCTTGTCTGAATGGAGGCTTTGA |
| Sequence | LAFRRTAPSPGTSPLGSAPEPPRRARDFVKTQLTAKDDASRARPFFLSEWRL |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2889997 | 2890155 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 1135136 | 1135288 | - | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 347721 | 347873 | + | NZ_CP026100.1 | Caulobacter flavus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP027850.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07310.15 | 0.67 | 2 | 3162.0 | same-strand | PAS domain |
| 2 | PF00732.21 | 0.67 | 2 | 1019.0 | opposite-strand | GMC oxidoreductase |
| 3 | PF05199.15 | 0.67 | 2 | 1019.0 | opposite-strand | GMC oxidoreductase |
| 4 | PF00132.26 | 1.0 | 3 | 179 | opposite-strand | Bacterial transferase hexapeptide (six repeats) |
| 5 | PF14602.8 | 1.0 | 3 | 179 | opposite-strand | Hexapeptide repeat of succinyl-transferase |
| 6 | PF02562.18 | 1.0 | 3 | 0 | same-strand | PhoH-like protein |
| 7 | PF13245.8 | 1.0 | 3 | 0 | same-strand | AAA domain |
| 8 | PF03169.17 | 1.0 | 3 | 1358 | same-strand | OPT oligopeptide transporter protein |
| 9 | PF08445.12 | 1.0 | 3 | 3420 | opposite-strand | FR47-like protein |
| 10 | PF00440.25 | 0.67 | 2 | 3854.5 | opposite-strand | Bacterial regulatory proteins, tetR family |
++ More..