Result : B1H013
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | AP009510.1 |
| Organism | Endomicrobium trichonymphae |
| Left | 541506 |
| Right | 541808 |
| Strand | + |
| Nucleotide Sequence | ATGACATTTATAAGAAAACCTGCAGGGCAGGCAAAACCTCAAAAGTATTCGACTGATGCTTATGGTCGTCCTGCCGGAAAGTTTAGAAGAAACGGACCGATAAGGAAAAAAGTTTGCCGTTTCTGTGCTGATAAAGTTGAGATAGATTACAAGAATTTAAGCCTGCTTCACACGTTTGTAACTGAAAAGGGCAAAATACTTTCGGGACGTATGACCGGCACATGTGCAAAACATCAAAGAGAACTTGATACAGCAATTAAAAGAGCAAGAATGATTGCGCTTTTGCCTTTTACAGTAAATTGA |
| Sequence | MTFIRKPAGQAKPQKYSTDAYGRPAGKFRRNGPIRKKVCRFCADKVEIDYKNLSLLHTFVTEKGKILSGRMTGTCAKHQRELDTAIKRARMIALLPFTVN |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | 18391199 |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1H013 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 34
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 18266 | 18556 | + | NZ_CP009498.1 | Endomicrobium proavitum |
| 2 | 121399 | 121689 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 3 | 5447816 | 5448073 | - | NZ_CP020953.1 | Clostridium drakei |
| 4 | 4596241 | 4596498 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 5 | 4473520 | 4473777 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 6 | 2905063 | 2905314 | - | NZ_HG917868.1 | Clostridium bornimense |
| 7 | 2029520 | 2029786 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 8 | 1234332 | 1234586 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 9 | 2001509 | 2001760 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 10 | 1235825 | 1236088 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 11 | 2439648 | 2439911 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 12 | 12986348 | 12986623 | - | NZ_CP016211.1 | Minicystis rosea |
| 13 | 3435564 | 3435833 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 14 | 673106 | 673378 | + | NC_018518.1 | Bordetella pertussis 18323 |
| 15 | 1956390 | 1956662 | + | NZ_AP019378.1 | Bordetella parapertussis |
| 16 | 1685717 | 1685989 | + | NZ_LR134326.1 | Bordetella bronchiseptica |
| 17 | 5759123 | 5759398 | + | NZ_CP027860.1 | Ahniella affigens |
| 18 | 9678515 | 9678814 | + | NC_010162.1 | Sorangium cellulosum So ce56 |
| 19 | 961683 | 961955 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 20 | 8763210 | 8763488 | + | NZ_CP012333.1 | Labilithrix luteola |
| 21 | 1921565 | 1921852 | - | NZ_AP018437.1 | Pelolinea submarina |
| 22 | 7044098 | 7044370 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 23 | 8140227 | 8140499 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 24 | 2125651 | 2125926 | - | NZ_CP013450.1 | Burkholderia cenocepacia |
| 25 | 2219790 | 2220065 | - | NC_007510.1 | Burkholderia lata |
| 26 | 6796130 | 6796402 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 27 | 2145258 | 2145533 | - | NZ_CP013401.1 | Burkholderia metallica |
| 28 | 2155205 | 2155480 | - | NZ_CP045235.1 | Burkholderia cepacia |
| 29 | 3403972 | 3404247 | - | NZ_CP011503.1 | Burkholderia pyrrocinia |
| 30 | 2081847 | 2082122 | - | NZ_CP013398.1 | Burkholderia seminalis |
| 31 | 3533495 | 3533758 | - | NZ_LR699011.1 | Roseburia hominis |
| 32 | 1233108 | 1233407 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 33 | 5236789 | 5237037 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 34 | 5434274 | 5434522 | - | NZ_CP032365.1 | Bacillus wiedmannii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009498.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01250.19 | 1.0 | 34 | 477.0 | same-strand | Ribosomal protein S6 |
| 2 | PF03948.16 | 0.76 | 26 | 28.0 | same-strand | Ribosomal protein L9, C-terminal domain |
| 3 | PF01281.21 | 0.76 | 26 | 28.0 | same-strand | Ribosomal protein L9, N-terminal domain |
++ More..