Result : EXP00348
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00348 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 1699323 |
| Right | 1699610 |
| Strand | + |
| Nucleotide Sequence | ATGTCGGGGAACTTCTCACCCGCGCCGCCGCAGAACATCTTGATGCCGCCACCGGTGCCGAGCGCTTCAATGCGCGGCGACTTCTTGCCGGTCTTCTTGGCGAAGTTCTCAGCCACGCGCGTCGAGAACGGGAACACGGTCGAAGAGCCGACCGCCCAGATCTGGTCGCGGGCCGCATGGGCTTGGTCGGCGACGGCGAGCAGAGCGACGGTGGCGACCGCGCCGATGAGCTTGTTCATGTCGTCAAATCCTGTCTCGTCCGGACGCAACGGAAGCGTGCCAGACTGA |
| Sequence | MSGNFSPAPPQNILMPPPVPSASMRGDFLPVFLAKFSATRVENGNTVEEPTAQIWSRAAWAWSATASRATVATAPMSLFMSSNPVSSGRNGSVPD |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1699323 | 1699610 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 765087 | 765323 | + | NZ_CP072793.1 | Thiothrix unzii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12849.9 | 1.0 | 2 | -235.0 | opposite-strand | PBP superfamily domain |
++ More..