Result : EXP00347
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00347 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 1529779 |
| Right | 1529883 |
| Strand | + |
| Nucleotide Sequence | ATGGTTATCAAGGGGGTGTGCTCCAACAGGCGATTCACACCGTGTAACGGAGGATTTCAGGTCACATTGAGCTCCGGCGTTCCGATAGTCTCCATGATGCAGTGA |
| Sequence | MVIKGVCSNRRFTPCNGGFQVTLSSGVPIVSMMQ |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1529779 | 1529883 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 888538 | 888624 | + | NC_020506.1 | Corynebacterium callunae DSM 20147 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00440.25 | 1.0 | 2 | 1846.5 | both-strands | Bacterial regulatory proteins, tetR family |
++ More..