Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00347 |
NCBI Accession ID | NC_011916.1 |
Organism | Caulobacter vibrioides NA1000 |
Left | 1529779 |
Right | 1529883 |
Strand | + |
Nucleotide Sequence | ATGGTTATCAAGGGGGTGTGCTCCAACAGGCGATTCACACCGTGTAACGGAGGATTTCAGGTCACATTGAGCTCCGGCGTTCCGATAGTCTCCATGATGCAGTGA |
Sequence | MVIKGVCSNRRFTPCNGGFQVTLSSGVPIVSMMQ |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 25078267 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 34 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1529779 | 1529883 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
2 | 888538 | 888624 | + | NC_020506.1 | Corynebacterium callunae DSM 20147 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00440.25 | 1.0 | 2 | 1846.5 | both-strands | Bacterial regulatory proteins, tetR family |