Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00346 |
NCBI Accession ID | NC_011916.1 |
Organism | Caulobacter vibrioides NA1000 |
Left | 1486209 |
Right | 1486346 |
Strand | + |
Nucleotide Sequence | CTGGGAGACGCCGCCATGAACGTATCGAAGATGAACCACGCGATGCTGTCGTTCGCCCTCTTGGGCGGCATGCTGGTCGGTGGTCGGCAGAGTTCGAAGCCGCCCAAATCCCCGTCGTCGAAGTCGGGGCGAAAATAG |
Sequence | LGDAAMNVSKMNHAMLSFALLGGMLVGGRQSSKPPKSPSSKSGRK |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 25078267 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 45 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1486224 | 1486346 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
2 | 1707640 | 1707774 | + | NZ_CP027850.1 | Caulobacter segnis |
3 | 2051031 | 2051159 | - | NZ_CP013002.1 | Caulobacter henricii |
4 | 4008528 | 4008638 | - | NZ_CP026100.1 | Caulobacter flavus |
5 | 3318057 | 3318179 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06945.15 | 0.6 | 3 | 4297 | opposite-strand | Protein of unknown function (DUF1289) |
2 | PF02277.19 | 1.0 | 5 | 3326 | same-strand | Phosphoribosyltransferase |
3 | PF02771.18 | 1.0 | 5 | 1858 | same-strand | Acyl-CoA dehydrogenase, N-terminal domain |
4 | PF00441.26 | 1.0 | 5 | 1237.0 | same-strand | Acyl-CoA dehydrogenase, C-terminal domain |
5 | PF02770.21 | 1.0 | 5 | 1237.0 | same-strand | Acyl-CoA dehydrogenase, middle domain |
6 | PF03641.16 | 1.0 | 5 | 485 | opposite-strand | Possible lysine decarboxylase |
7 | PF00005.29 | 1.0 | 5 | 1969 | same-strand | ABC transporter |
8 | PF00664.25 | 1.0 | 5 | 1969 | same-strand | ABC transporter transmembrane region |
9 | PF13191.8 | 1.0 | 5 | 1969 | same-strand | AAA ATPase domain |
10 | PF00903.27 | 0.8 | 4 | 3882.0 | same-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
11 | PF13669.8 | 0.8 | 4 | 3882.0 | same-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
12 | PF18029.3 | 0.8 | 4 | 3882.0 | same-strand | Glyoxalase-like domain |