Result : EXP00341
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00341 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 861178 |
| Right | 861285 |
| Strand | + |
| Nucleotide Sequence | CTGTCGATGTCGGGTGGACAAACGGCCTATCTGGCTTTGGTGATCGGCGCGTTCGCGGCCTTCGCCGTCGCGCTGTTCACGACCCATATCCGGGTCAATCTGAAATAA |
| Sequence | LSMSGGQTAYLALVIGAFAAFAVALFTTHIRVNLK |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 861184 | 861285 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 3957564 | 3957665 | - | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 635191 | 635292 | + | NZ_CP013002.1 | Caulobacter henricii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP027850.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00072.26 | 1.0 | 3 | 1597 | opposite-strand | Response regulator receiver domain |
| 2 | PF00196.21 | 1.0 | 3 | 1597 | opposite-strand | Bacterial regulatory proteins, luxR family |
| 3 | PF08281.14 | 1.0 | 3 | 1597 | opposite-strand | Sigma-70, region 4 |
| 4 | PF06490.13 | 1.0 | 3 | 1597 | opposite-strand | Flagellar regulatory protein FleQ |
| 5 | PF02518.28 | 1.0 | 3 | 117 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 6 | PF00989.27 | 1.0 | 3 | 117 | opposite-strand | PAS fold |
| 7 | PF00512.27 | 1.0 | 3 | 117 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 8 | PF13426.9 | 1.0 | 3 | 117 | opposite-strand | PAS domain |
| 9 | PF00005.29 | 1.0 | 3 | 800.5 | opposite-strand | ABC transporter |
| 10 | PF00664.25 | 1.0 | 3 | 8 | opposite-strand | ABC transporter transmembrane region |
| 11 | PF01654.19 | 1.0 | 3 | 3372 | same-strand | Cytochrome bd terminal oxidase subunit I |
| 12 | PF02322.17 | 1.0 | 3 | 4948 | same-strand | Cytochrome bd terminal oxidase subunit II |
| 13 | PF08173.13 | 1.0 | 3 | 6118 | same-strand | Membrane bound YbgT-like protein |
| 14 | PF13545.8 | 0.67 | 2 | 2793.5 | opposite-strand | Crp-like helix-turn-helix domain |
| 15 | PF00325.22 | 0.67 | 2 | 2793.5 | opposite-strand | Bacterial regulatory proteins, crp family |
| 16 | PF00027.31 | 0.67 | 2 | 2793.5 | opposite-strand | Cyclic nucleotide-binding domain |
| 17 | PF07690.18 | 0.67 | 2 | 3443.5 | same-strand | Major Facilitator Superfamily |
++ More..