Result : EXP00334
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00334 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 3153169 |
| Right | 3153333 |
| Strand | + |
| Nucleotide Sequence | ATGGAGACCACGATGGTTCTGAGAACGACGGGAGCGCGCTGGCTGGCTACGATGATGCGAGCCGAGCGCGACGATGACGATTGGCCCGGGGACGACGCCTGGCTGCTGTTCGGCCCGAGCGATCCGGCCGTGGTGGAGCGCCGGGAGCCGCCCACGCACGAGTAG |
| Sequence | METTMVLRTTGARWLATMMRAERDDDDWPGDDAWLLFGPSDPAVVERREPPTHE |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3153169 | 3153333 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 1119524 | 1119682 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 3 | 1011556 | 1011705 | - | NZ_CP027850.1 | Caulobacter segnis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02786.19 | 0.67 | 2 | 2993.0 | opposite-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 2 | PF02787.21 | 0.67 | 2 | 2993.0 | opposite-strand | Carbamoyl-phosphate synthetase large chain, oligomerisation domain |
| 3 | PF02142.24 | 0.67 | 2 | 2993.0 | opposite-strand | MGS-like domain |
| 4 | PF02222.24 | 0.67 | 2 | 2993.0 | opposite-strand | ATP-grasp domain |
| 5 | PF02655.16 | 0.67 | 2 | 2993.0 | opposite-strand | ATP-grasp domain |
| 6 | PF01734.24 | 0.67 | 2 | 419.0 | opposite-strand | Patatin-like phospholipase |
| 7 | PF00313.24 | 0.67 | 2 | 253.5 | opposite-strand | 'Cold-shock' DNA-binding domain |
| 8 | PF01066.23 | 1.0 | 3 | 912 | opposite-strand | CDP-alcohol phosphatidyltransferase |
| 9 | PF07536.16 | 0.67 | 2 | 2425.0 | same-strand | HWE histidine kinase |
| 10 | PF07568.14 | 0.67 | 2 | 2425.0 | same-strand | Histidine kinase |
++ More..