Result : EXP00332

Protein Information

• Protein name: EXP00332
• NCBI Accession ID: NC_000913.3
• Organism: Escherichia coli str. K-12 substr. MG1655
• Left: 2710009
• Right: 2710131
• Strand: -
• Nucleotide Sequence: ATGCGTTACGGAACTTTACAAAAACGAGACACTCTAACCCTTTGCTTGCTCAAATTGCAGCTAATGGAGTGGCGTTTCGATAGCGCGTGGAAATTTGGTTTGGGGAGACTTTACCTCGGATGA
• Sequence: MRYGTLQKRDTLTLCLLKLQLMEWRFDSAWKFGLGRLYLG
• Source of smORF: Ribo-seq
• Pubmed ID: 30904393 27013550
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 40

Conservation Analysis

No. of Species: 18

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3430517	3430639	-	NC_002695.2	Escherichia coli O157:H7 str. Sakai
2	2710009	2710131	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
3	2707223	2707345	-	NC_004337.2	Shigella flexneri 2a str. 301
4	4061631	4061753	+	NZ_CP057657.1	Escherichia fergusonii
5	1003139	1003261	+	NZ_CP061527.1	Shigella dysenteriae
6	3230584	3230706	-	NZ_LR134340.1	Escherichia marmotae
7	5018632	5018754	-	NZ_LT556085.1	Citrobacter amalonaticus
8	1820303	1820425	+	NZ_CP045205.1	Citrobacter telavivensis
9	203099	203221	+	NC_009792.1	Citrobacter koseri ATCC BAA-895
10	2656636	2656758	-	NC_013716.1	Citrobacter rodentium ICC168
11	4666129	4666251	+	NZ_CP038469.1	Citrobacter tructae
12	2780003	2780125	-	NC_003197.2	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
13	687096	687218	-	NZ_CP053416.1	Salmonella bongori
14	3707020	3707142	+	NZ_CP044098.1	Citrobacter portucalensis
15	1401519	1401641	-	NZ_CP033744.1	Citrobacter freundii
16	2668611	2668733	-	NZ_AP014857.1	Escherichia albertii
17	949809	949916	+	NZ_CP023525.1	Cedecea neteri
18	906797	906904	+	NZ_LR134201.1	Cedecea lapagei
19	1492910	1493014	+	NZ_CP036175.1	Klebsiella huaxiensis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_002695.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00009.29	0.78	14	2885	same-strand	Elongation factor Tu GTP binding domain
2	PF06421.14	0.78	14	2885	same-strand	GTP-binding protein LepA C-terminus
3	PF00679.26	0.78	14	2885	same-strand	Elongation factor G C-terminus
4	PF03144.27	0.78	14	2885	same-strand	Elongation factor Tu domain 2
5	PF01926.25	0.78	14	2885	same-strand	50S ribosome-binding GTPase
6	PF00071.24	0.72	13	2887.5	same-strand	Ras family
7	PF04246.14	1.0	18	2207	same-strand	Positive regulator of sigma(E), RseC/MucC
8	PF03888.16	1.0	18	1254	same-strand	MucB/RseB N-terminal domain
9	PF17188.6	1.0	18	1254	same-strand	MucB/RseB C-terminal domain
10	PF03872.15	1.0	18	604	same-strand	Anti sigma-E protein RseA, N-terminal domain
11	PF03873.15	1.0	18	604	same-strand	Anti sigma-E protein RseA, C-terminal domain
12	PF08281.14	1.0	18	-3	same-strand	Sigma-70, region 4
13	PF04542.16	1.0	18	-3	same-strand	Sigma-70 region 2
14	PF04545.18	1.0	18	-3	same-strand	Sigma-70, region 4
15	PF07638.13	1.0	18	-3	same-strand	ECF sigma factor
16	PF00890.26	1.0	18	306	opposite-strand	FAD binding domain
17	PF00270.31	1.0	18	2781	opposite-strand	DEAD/DEAH box helicase
18	PF00271.33	1.0	18	2781	opposite-strand	Helicase conserved C-terminal domain
19	PF04851.17	1.0	18	2781	opposite-strand	Type III restriction enzyme, res subunit
20	PF13245.8	0.94	17	2781.0	opposite-strand	AAA domain