Result : EXP00328
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00328 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 2909663 |
| Right | 2909758 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGTTTGTGGCACAGGTCATGTTCGGGTATACTGCTTTCCCGTCTTGGTTATTCCATCGTCTTTTCAACCTAACTTCTCAGGTTCAGCATGA |
| Sequence | MKVCGTGHVRVYCFPVLVIPSSFQPNFSGSA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 51
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 842377 | 842472 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 3632189 | 3632284 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 2838135 | 2838230 | - | NZ_AP014857.1 | Escherichia albertii |
| 4 | 2909663 | 2909758 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 5 | 2869284 | 2869379 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 3834887 | 3834982 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 3393179 | 3393274 | - | NZ_LR134340.1 | Escherichia marmotae |
| 8 | 3100386 | 3100481 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 9 | 3843816 | 3843911 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 10 | 914871 | 914966 | - | NZ_CP053416.1 | Salmonella bongori |
| 11 | 4339502 | 4339597 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 12 | 748061 | 748156 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 13 | 968715 | 968810 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 14 | 1206686 | 1206781 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 15 | 1112717 | 1112812 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 16 | 2104520 | 2104615 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 17 | 3654908 | 3655003 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 18 | 2048505 | 2048600 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 19 | 3719587 | 3719682 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 20 | 2446389 | 2446481 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 21 | 1592987 | 1593079 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 22 | 136580 | 136672 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 23 | 1019113 | 1019205 | + | NZ_CP054254.1 | Klebsiella variicola |
| 24 | 4230465 | 4230557 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 25 | 1006583 | 1006675 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 26 | 1001476 | 1001568 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 27 | 883489 | 883581 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 28 | 1692126 | 1692218 | - | NZ_CP033744.1 | Citrobacter freundii |
| 29 | 4374380 | 4374472 | + | NZ_CP038469.1 | Citrobacter tructae |
| 30 | 985434 | 985526 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 31 | 3404940 | 3405032 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 32 | 1040690 | 1040782 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 33 | 647501 | 647593 | - | NZ_CP026047.1 | Raoultella planticola |
| 34 | 963096 | 963188 | + | NZ_CP041247.1 | Raoultella electrica |
| 35 | 1479960 | 1480052 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 36 | 4641485 | 4641577 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 37 | 1073540 | 1073632 | + | NZ_CP050508.1 | Raoultella terrigena |
| 38 | 972553 | 972645 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 39 | 4058000 | 4058092 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 40 | 3836569 | 3836661 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 41 | 3752095 | 3752187 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 42 | 3749102 | 3749194 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 43 | 3698470 | 3698562 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 44 | 3525413 | 3525505 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 45 | 5209693 | 5209785 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 46 | 3200504 | 3200596 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 47 | 3737991 | 3738083 | - | NC_015968.1 | Enterobacter soli |
| 48 | 4653848 | 4653940 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 49 | 232784 | 232876 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 50 | 1557680 | 1557772 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 51 | 912364 | 912471 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 52 | 925961 | 926065 | + | NZ_CP011104.1 | Photorhabdus thracensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP057657.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01938.22 | 0.94 | 48 | 3362 | same-strand | TRAM domain |
| 2 | PF13328.8 | 1.0 | 51 | 1048.0 | same-strand | HD domain |
| 3 | PF04607.19 | 1.0 | 51 | 1048.0 | same-strand | Region found in RelA / SpoT proteins |
| 4 | PF02824.23 | 1.0 | 51 | 1048.0 | same-strand | TGS domain |
| 5 | PF13291.8 | 1.0 | 51 | 1048.0 | same-strand | ACT domain |
| 6 | PF19296.1 | 1.0 | 51 | 1048.0 | same-strand | Domain of unknown function (DUF5913) |
| 7 | PF01842.27 | 1.0 | 51 | 1048.0 | same-strand | ACT domain |
| 8 | PF03819.19 | 1.0 | 51 | 136.0 | same-strand | MazG nucleotide pyrophosphohydrolase domain |
| 9 | PF06418.16 | 1.0 | 51 | -3.0 | same-strand | CTP synthase N-terminus |
| 10 | PF00117.30 | 1.0 | 51 | -3.0 | same-strand | Glutamine amidotransferase class-I |
| 11 | PF00113.24 | 1.0 | 51 | 1717.0 | same-strand | Enolase, C-terminal TIM barrel domain |
| 12 | PF03952.18 | 1.0 | 51 | 1717.0 | same-strand | Enolase, N-terminal domain |
| 13 | PF09984.11 | 0.88 | 45 | 4714 | opposite-strand | Single cache domain 4 |
| 14 | PF02518.28 | 0.88 | 45 | 4714 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 15 | PF00072.26 | 0.88 | 45 | 4742 | opposite-strand | Response regulator receiver domain |
| 16 | PF00512.27 | 0.88 | 45 | 4714 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 17 | PF01627.25 | 0.88 | 45 | 4742 | opposite-strand | Hpt domain |
| 18 | PF00672.27 | 0.88 | 45 | 4714 | opposite-strand | HAMP domain |
| 19 | PF02595.17 | 0.73 | 37 | 7609 | same-strand | Glycerate kinase family |
++ More..