Result : B1GZP2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S21 |
| NCBI Accession ID | AP009510.1 |
| Organism | Endomicrobium trichonymphae |
| Left | 359874 |
| Right | 360080 |
| Strand | + |
| Nucleotide Sequence | ATGGTCAGTGTTAAAGTGCGCGAAGGCGAGTCTATTGAAGAAGCTATCAGACGTTTTAAGAGAGAATGCGAAAGAAACGGAGTAATGCAGGAAATAAAAAAACGCGAATTTTATAAAACTCCAAGTATTTTAAAAAAAGAAAAACTTGCAGAAACAAAAAGGAAAATCCGTCGTAAAATGTTTAAGGACAGTAAGTGGTCAAAGTGA |
| Sequence | MVSVKVREGESIEEAIRRFKRECERNGVMQEIKKREFYKTPSILKKEKLAETKRKIRRKMFKDSKWSK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed |
| Pubmed ID | 18391199 |
| Domain | CDD:412427 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1GZP2 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 94
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 952722 | 952928 | - | NZ_CP009498.1 | Endomicrobium proavitum |
| 2 | 764605 | 764784 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 3 | 4405960 | 4406175 | + | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 4 | 4373670 | 4373885 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 5 | 3037496 | 3037711 | + | NZ_CP016878.1 | Xanthomonas hortorum |
| 6 | 2920727 | 2920942 | + | NC_017033.1 | Frateuria aurantia DSM 6220 |
| 7 | 2330546 | 2330761 | + | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 8 | 966976 | 967191 | - | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 9 | 434086 | 434301 | - | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 10 | 292851 | 293066 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 11 | 416303 | 416518 | - | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 12 | 87461 | 87676 | - | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 13 | 398931 | 399146 | - | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 14 | 1537886 | 1538101 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 15 | 3123917 | 3124132 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 16 | 4482514 | 4482729 | + | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 17 | 4563162 | 4563377 | + | NZ_CP048044.1 | Xanthomonas citri |
| 18 | 3355843 | 3356058 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
| 19 | 416659 | 416874 | - | NZ_CP046570.1 | Xanthomonas albilineans |
| 20 | 2179055 | 2179270 | + | NZ_CP053627.1 | Xylella taiwanensis |
| 21 | 315207 | 315422 | - | NZ_CP064030.1 | Dyella caseinilytica |
| 22 | 2383278 | 2383457 | + | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 23 | 3332967 | 3333182 | - | NZ_CP071517.1 | Lysobacter arenosi |
| 24 | 1910522 | 1910737 | + | NZ_CP029556.1 | Lysobacter oculi |
| 25 | 5216765 | 5216980 | + | NZ_CP011129.1 | Lysobacter antibioticus |
| 26 | 3881683 | 3881898 | + | NZ_CP046603.1 | Lysobacter soli |
| 27 | 464851 | 465066 | - | NZ_AP018560.1 | Aerosticca soli |
| 28 | 337738 | 337953 | - | NC_020541.1 | Rhodanobacter denitrificans |
| 29 | 2529158 | 2529334 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 30 | 1903305 | 1903520 | + | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 31 | 272779 | 272994 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
| 32 | 4301835 | 4302050 | + | NZ_CP035704.1 | Pseudolysobacter antarcticus |
| 33 | 1151281 | 1151463 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 34 | 411483 | 411656 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 35 | 1138750 | 1138926 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 36 | 3758754 | 3758930 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 37 | 5259682 | 5259858 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 38 | 488354 | 488530 | + | NZ_CP020953.1 | Clostridium drakei |
| 39 | 3140877 | 3141053 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 40 | 891560 | 891736 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 41 | 585225 | 585398 | + | NZ_CP029256.1 | Christensenella minuta |
| 42 | 2388962 | 2389138 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 43 | 101425 | 101640 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 44 | 1476261 | 1476437 | + | NZ_LR699011.1 | Roseburia hominis |
| 45 | 984967 | 985143 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 46 | 1149329 | 1149505 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 47 | 1749935 | 1750111 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 48 | 602252 | 602425 | - | NZ_CP046314.1 | Gemella morbillorum |
| 49 | 300606 | 300779 | + | NZ_LR134484.1 | Gemella haemolysans |
| 50 | 1310192 | 1310368 | + | NZ_CP040924.1 | Clostridium thermarum |
| 51 | 1964936 | 1965112 | - | NZ_CP016786.1 | Clostridium isatidis |
| 52 | 511737 | 511913 | - | NZ_CP023671.1 | Clostridium septicum |
| 53 | 482878 | 483093 | + | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 54 | 2475277 | 2475453 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 55 | 1101230 | 1101406 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 56 | 1469586 | 1469759 | + | NZ_CP016538.2 | Planococcus maritimus |
| 57 | 3196418 | 3196594 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 58 | 2317242 | 2317418 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 59 | 1605623 | 1605838 | - | NZ_LR134365.1 | Cardiobacterium hominis |
| 60 | 1442883 | 1443056 | + | NZ_CP016540.2 | Planococcus versutus |
| 61 | 1475800 | 1475973 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 62 | 266600 | 266773 | - | NZ_CP013661.2 | Planococcus kocurii |
| 63 | 1516345 | 1516518 | + | NZ_CP019401.1 | Planococcus faecalis |
| 64 | 1594983 | 1595156 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 65 | 505253 | 505429 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 66 | 1761636 | 1761812 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 67 | 1097375 | 1097551 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 68 | 1196561 | 1196737 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 69 | 1359595 | 1359771 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 70 | 40688 | 40864 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 71 | 1391311 | 1391487 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 72 | 2930027 | 2930203 | - | NZ_CP030775.1 | Clostridium butyricum |
| 73 | 1216535 | 1216711 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 74 | 854363 | 854539 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 75 | 984667 | 984843 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 76 | 1058594 | 1058770 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 77 | 985641 | 985817 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 78 | 2020264 | 2020440 | - | NZ_CP027770.1 | Staphylococcus felis |
| 79 | 858259 | 858435 | - | NZ_CP029476.1 | Lactobacillus apis |
| 80 | 643313 | 643489 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 81 | 880439 | 880615 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 82 | 1058395 | 1058571 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 83 | 1180791 | 1180967 | - | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 84 | 980547 | 980723 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 85 | 918027 | 918203 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 86 | 969247 | 969423 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 87 | 1960615 | 1960788 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 88 | 1507127 | 1507300 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 89 | 1056872 | 1057048 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 90 | 1479593 | 1479766 | + | NZ_CP059540.1 | Planococcus maritimus |
| 91 | 1224010 | 1224183 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 92 | 1370518 | 1370691 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 93 | 2863497 | 2863712 | - | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 94 | 3270976 | 3271152 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 95 | 1121518 | 1121691 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP027228.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09424.12 | 0.66 | 62 | 127.0 | same-strand | Yqey-like protein |
++ More..