Result : EXP00317
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00317 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 478631 |
| Right | 478732 |
| Strand | - |
| Nucleotide Sequence | ATGATCGTTTCCACCCATCACTTCATGAAATACCAGCTCTACCTCCTTATCTCCAGCCAGCCTTTTTCCACAATCAGATATACTTTCCCTACACTGTGTTAA |
| Sequence | MIVSTHHFMKYQLYLLISSQPFSTIRYTFPTLC |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 478631 | 478732 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 415162 | 415263 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 544697 | 544804 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 3158973 | 3159080 | - | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09619.12 | 0.67 | 2 | 2682 | opposite-strand | Type III secretion system lipoprotein chaperone (YscW) |
| 2 | PF01035.22 | 0.67 | 2 | 2338 | same-strand | 6-O-methylguanine DNA methyltransferase, DNA binding domain |
| 3 | PF07237.13 | 0.67 | 2 | 1606 | opposite-strand | Protein of unknown function (DUF1428) |
| 4 | PF00563.22 | 0.67 | 2 | 14 | same-strand | EAL domain |
| 5 | PF12792.9 | 0.67 | 2 | 14 | same-strand | CSS motif domain associated with EAL |
| 6 | PF10777.11 | 1.0 | 3 | 46.0 | same-strand | Inner membrane protein YlaC |
| 7 | PF12464.10 | 0.67 | 2 | 629 | same-strand | Maltose acetyltransferase |
| 8 | PF14602.8 | 1.0 | 3 | 632.0 | same-strand | Hexapeptide repeat of succinyl-transferase |
| 9 | PF00132.26 | 1.0 | 3 | 632.0 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 10 | PF05321.13 | 1.0 | 3 | 1355.0 | same-strand | Haemolysin expression modulating protein |
| 11 | PF10757.11 | 1.0 | 3 | 1599.0 | same-strand | Biofilm formation regulator YbaJ |
| 12 | PF00873.21 | 0.67 | 2 | 2516 | same-strand | AcrB/AcrD/AcrF family |
++ More..