Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00317 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 478631 |
Right | 478732 |
Strand | - |
Nucleotide Sequence | ATGATCGTTTCCACCCATCACTTCATGAAATACCAGCTCTACCTCCTTATCTCCAGCCAGCCTTTTTCCACAATCAGATATACTTTCCCTACACTGTGTTAA |
Sequence | MIVSTHHFMKYQLYLLISSQPFSTIRYTFPTLC |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 27013550 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 33 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 478631 | 478732 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 415162 | 415263 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 544697 | 544804 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 3158973 | 3159080 | - | NZ_CP061527.1 | Shigella dysenteriae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF09619.12 | 0.67 | 2 | 2682 | opposite-strand | Type III secretion system lipoprotein chaperone (YscW) |
2 | PF01035.22 | 0.67 | 2 | 2338 | same-strand | 6-O-methylguanine DNA methyltransferase, DNA binding domain |
3 | PF07237.13 | 0.67 | 2 | 1606 | opposite-strand | Protein of unknown function (DUF1428) |
4 | PF00563.22 | 0.67 | 2 | 14 | same-strand | EAL domain |
5 | PF12792.9 | 0.67 | 2 | 14 | same-strand | CSS motif domain associated with EAL |
6 | PF10777.11 | 1.0 | 3 | 46.0 | same-strand | Inner membrane protein YlaC |
7 | PF12464.10 | 0.67 | 2 | 629 | same-strand | Maltose acetyltransferase |
8 | PF14602.8 | 1.0 | 3 | 632.0 | same-strand | Hexapeptide repeat of succinyl-transferase |
9 | PF00132.26 | 1.0 | 3 | 632.0 | same-strand | Bacterial transferase hexapeptide (six repeats) |
10 | PF05321.13 | 1.0 | 3 | 1355.0 | same-strand | Haemolysin expression modulating protein |
11 | PF10757.11 | 1.0 | 3 | 1599.0 | same-strand | Biofilm formation regulator YbaJ |
12 | PF00873.21 | 0.67 | 2 | 2516 | same-strand | AcrB/AcrD/AcrF family |