Result : EXP00313
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00313 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 3937171 |
| Right | 3937359 |
| Strand | - |
| Nucleotide Sequence | TTGAAGATTAAGAATGTGGTCAGCATTAATGCTGCCAAGAACAACGAGGCTGCCTGCGTTTTGCATATTCGGGATGTCCATAAAATGCGCCACCGTGTTAGGGTGGCGCGTGCCCTGCTTTTCTTTATATTACACGTTCATCTGTCGATGACGTATTTATGTCACCATCAGGTCATACAACCTGATTAA |
| Sequence | LKIKNVVSINAAKNNEAACVLHIRDVHKMRHRVRVARALLFFILHVHLSMTYLCHHQVIQPD |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3937171 | 3937359 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3946651 | 3946839 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 4730740 | 4730928 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 4264738 | 4264926 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 2835520 | 2835708 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 4405749 | 4405937 | + | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02705.18 | 0.6 | 3 | 3987.0 | opposite-strand | K+ potassium transporter |
| 2 | PF05025.15 | 0.6 | 3 | 3401.0 | opposite-strand | RbsD / FucU transport protein family |
| 3 | PF00005.29 | 0.8 | 4 | 1888 | opposite-strand | ABC transporter |
| 4 | PF02653.18 | 1.0 | 5 | 918.0 | opposite-strand | Branched-chain amino acid transport system / permease component |
| 5 | PF13407.8 | 1.0 | 5 | 868.0 | opposite-strand | Periplasmic binding protein domain |
| 6 | PF00532.23 | 1.0 | 5 | 868.0 | opposite-strand | Periplasmic binding proteins and sugar binding domain of LacI family |
| 7 | PF13377.8 | 1.0 | 5 | 868 | opposite-strand | Periplasmic binding protein-like domain |
| 8 | PF00294.26 | 1.0 | 5 | -65.0 | opposite-strand | pfkB family carbohydrate kinase |
| 9 | PF00356.23 | 1.0 | 5 | 868.0 | opposite-strand | Bacterial regulatory proteins, lacI family |
| 10 | PF07690.18 | 0.6 | 3 | 1826.0 | same-strand | Major Facilitator Superfamily |
| 11 | PF07729.14 | 1.0 | 5 | 3276.0 | same-strand | FCD domain |
| 12 | PF00392.23 | 1.0 | 5 | 3276.0 | same-strand | Bacterial regulatory proteins, gntR family |
++ More..