Result : EXP00310
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00310 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 432010 |
| Right | 432111 |
| Strand | - |
| Nucleotide Sequence | ATGATTTTTATAATAGGCTCCTCTGTATACGAAATATTTAGAAACGCAATTTGCGCCTTTTTCACTCCCGCAAGGGATTTTCAAACAGTGGCATACATATGA |
| Sequence | MIFIIGSSVYEIFRNAICAFFTPARDFQTVAYI |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 496266 | 496367 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 432010 | 432111 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 361508 | 361609 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3302506 | 3302607 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 1073850 | 1073951 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 443918 | 444019 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 4478341 | 4478442 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 8 | 2635216 | 2635317 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02355.18 | 1.0 | 7 | 2160 | opposite-strand | Protein export membrane protein |
| 2 | PF07549.16 | 1.0 | 7 | 1636.5 | opposite-strand | SecD/SecF GG Motif |
| 3 | PF01844.25 | 0.71 | 5 | 1058.0 | opposite-strand | HNH endonuclease |
| 4 | PF03502.15 | 1.0 | 7 | -3.0 | same-strand | Nucleoside-specific channel-forming protein, Tsx |
| 5 | PF11622.10 | 1.0 | 7 | 201.0 | same-strand | Protein of unknown function (DUF3251) |
| 6 | PF03477.18 | 1.0 | 7 | 891.0 | opposite-strand | ATP cone domain |
| 7 | PF01872.19 | 1.0 | 7 | 1344.0 | opposite-strand | RibD C-terminal domain |
| 8 | PF00383.25 | 1.0 | 7 | 1344.0 | opposite-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
| 9 | PF14437.8 | 0.71 | 5 | 1344.0 | opposite-strand | MafB19-like deaminase |
| 10 | PF00885.21 | 1.0 | 7 | 2536.0 | opposite-strand | 6,7-dimethyl-8-ribityllumazine synthase |
| 11 | PF01029.20 | 1.0 | 7 | 3026.0 | opposite-strand | NusB family |
| 12 | PF02699.17 | 0.71 | 5 | 4391 | opposite-strand | Preprotein translocase subunit |
| 13 | PF13721.8 | 1.0 | 7 | 2556 | opposite-strand | SecD export protein N-terminal TM region |
++ More..